| Name | O_ErmoMG11485_internal:A_ErmoMG_comp35933_c0_seq1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | ATP-binding_cassette_sub-family_A_ABCA1,_partial_[Danaus_plexippus] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0005215 |
F |
transporter activity |
| GO:0005524 |
F |
ATP binding |
| GO:0005764 |
C |
lysosome |
| GO:0005765 |
C |
lysosomal membrane |
| GO:0005768 |
C |
endosome |
| GO:0005815 |
C |
microtubule organizing center |
| GO:0006357 |
P |
regulation of transcription by RNA polymerase II |
| GO:0006810 |
P |
transport |
| GO:0008152 |
P |
metabolic process |
| GO:0010008 |
C |
endosome membrane |
| GO:0016020 |
C |
membrane |
| GO:0016021 |
C |
integral component of membrane |
| GO:0016023 |
C |
cytoplasmic vesicle |
| GO:0016887 |
F |
ATP hydrolysis activity |
| GO:0032383 |
P |
regulation of intracellular cholesterol transport |
| GO:0033344 |
P |
cholesterol efflux |
| GO:0033700 |
P |
phospholipid efflux |
| GO:0042626 |
F |
ATPase-coupled transmembrane transporter activity |
| GO:0042632 |
P |
cholesterol homeostasis |
| GO:0048545 |
P |
response to steroid hormone |
| GO:0055085 |
P |
transmembrane transport |
|
| RNA-seq Entry | A_ErmoMG_comp35933_c0_seq1 |
Sequence
(Amino Acid) | GYNDALLSVVHDEEPKGVPIGVNIQNLTKKYKGRKKVVDNLNLRLYENEITVLLGHNGAG
KTTTISMLTGMVPPTSGSVKINGYDIVTETEQARHSLGICPQHNVLFPDLTVAEHLIFYS
KLKGIPESKIQEEIDHFVKLLELEDKRHSAASSLSGGQNRRLSA
(53 a.a.) |
