SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG11385_complete:A_ErmoMG_comp35876_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_zinc_finger_protein_ZPR1_[Papilio_xuthus]
Ontology
GO:0000226 P microtubule cytoskeleton organization
GO:0001833 P inner cell mass cell proliferation
GO:0001834 P trophectodermal cell proliferation
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0006397 P mRNA processing
GO:0007275 P multicellular organism development
GO:0008270 F zinc ion binding
GO:0008380 P RNA splicing
GO:0010628 P positive regulation of gene expression
GO:0015030 C Cajal body
GO:0021510 P spinal cord development
GO:0030154 P cell differentiation
GO:0030424 C axon
GO:0030426 C growth cone
GO:0030576 P Cajal body organization
GO:0030971 F receptor tyrosine kinase binding
GO:0031369 F translation initiation factor binding
GO:0031641 P regulation of myelination
GO:0032797 C SMN complex
GO:0033120 P positive regulation of RNA splicing
GO:0042023 P DNA endoreduplication
GO:0042307 P positive regulation of protein import into nucleus
GO:0042995 C cell projection
GO:0043025 C neuronal cell body
GO:0043204 C perikaryon
GO:0045927 P positive regulation of growth
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0061564 P axon development
GO:0071364 P cellular response to epidermal growth factor stimulus
GO:0071931 P positive regulation of transcription involved in G1/S transition of mitotic cell cycle
GO:0097504 C Gemini of coiled bodies
GO:1902742 P apoptotic process involved in development
GO:1990261 P pre-mRNA catabolic process
GO:2000672 P negative regulation of motor neuron apoptotic process
RNA-seq EntryA_ErmoMG_comp35876_c0_seq1
Sequence
(Amino Acid)
MCSDLKPMFRDLTAEDPDPEVTEIESFCMNCHENGMTRLLLTRIPYYKNVVIMSFSCEEC
GYENNEIQPGGEYAELGVRWKLRVENHTDLNRQVVKSDYTSVKIPELDFEIPARSQKGEV
TTVEGIVSRAIAGLTQDQVLRRSQHPDAAAQIDSFITQLEGLKGLSTPWTLLLEDISGNC
FIENPELPKKDPRCERTDFKRTKTQNHELGIFTHNEVSEDATPTPLTPYSEKLLTPADPA
QCSLEHMTQDEVMLFRTNCPDCNAPADTNMKITKIPHFKEVVIMATTCEYCGHRTNEVKS
GSGIEDMGVKFEVRVANKDDFSRDILKSETCTMSIPELELEVGGHALGGRFTTAEGLLRA
SVAQLEESLTGDAVTKPALQRFIDRLKDVIELKERVTIVLDDPAGNSYVQSLHDDPLTPD
DGLKIERYERTFDQNEELGINDMKTENYQES
*(149 a.a.)

- SilkBase 1999-2023 -