SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG11383_complete:A_ErmoMG_comp35874_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		dysbindin-like_protein_[Bombyx_mori]
Ontology
GO:0001956 P positive regulation of neurotransmitter secretion
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005886 C plasma membrane
GO:0008089 P anterograde axonal transport
GO:0010008 C endosome membrane
GO:0010628 P positive regulation of gene expression
GO:0014059 P regulation of dopamine secretion
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0030054 C cell junction
GO:0030424 C axon
GO:0030426 C growth cone
GO:0030659 C cytoplasmic vesicle membrane
GO:0030672 C synaptic vesicle membrane
GO:0031083 C BLOC-1 complex
GO:0031175 P neuron projection development
GO:0031410 C cytoplasmic vesicle
GO:0031532 P actin cytoskeleton reorganization
GO:0033162 C melanosome membrane
GO:0042734 C presynaptic membrane
GO:0043005 C neuron projection
GO:0043197 C dendritic spine
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0048490 P anterograde synaptic vesicle transport
GO:0048812 P neuron projection morphogenesis
GO:0060159 P regulation of dopamine receptor signaling pathway
GO:1904115 C axon cytoplasm
RNA-seq EntryA_ErmoMG_comp35874_c0_seq1
Sequence
(Amino Acid)
MDSMKTLQTMMKTVEEELVEFEDVVEKSKQERWKLDHQYHLTLYKERKMASLEDVRNKLA
RDNTEKSIEKERQQIASLQAKREDSDIAFQYDVAKYLANGNLPTVPKSSPSKMTLEQIQL
DEDKTDLEKFLDS
*(43 a.a.)

- SilkBase 1999-2023 -