SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG11363_3prime_partial:A_ErmoMG_comp35866_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		Hamartin_[Papilio_xuthus]
Ontology
GO:0001822 P kidney development
GO:0001843 P neural tube closure
GO:0001952 P regulation of cell-matrix adhesion
GO:0002250 P adaptive immune response
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005884 C actin filament
GO:0005886 C plasma membrane
GO:0005938 C cell cortex
GO:0006407 P rRNA export from nucleus
GO:0006417 P regulation of translation
GO:0006813 P potassium ion transport
GO:0007160 P cell-matrix adhesion
GO:0007399 P nervous system development
GO:0008285 P negative regulation of cell population proliferation
GO:0008344 P adult locomotory behavior
GO:0016020 C membrane
GO:0016242 P negative regulation of macroautophagy
GO:0017148 P negative regulation of translation
GO:0021766 P hippocampus development
GO:0021987 P cerebral cortex development
GO:0030027 C lamellipodium
GO:0030030 P cell projection organization
GO:0030426 C growth cone
GO:0030695 F GTPase regulator activity
GO:0032007 P negative regulation of TOR signaling
GO:0032794 F GTPase activating protein binding
GO:0032868 P response to insulin
GO:0032956 P regulation of actin cytoskeleton organization
GO:0033596 C TSC1-TSC2 complex
GO:0042552 P myelination
GO:0043087 P regulation of GTPase activity
GO:0043231 C intracellular membrane-bounded organelle
GO:0043234 C protein-containing complex
GO:0043379 P memory T cell differentiation
GO:0043666 P regulation of phosphoprotein phosphatase activity
GO:0045792 P negative regulation of cell size
GO:0045859 P regulation of protein kinase activity
GO:0046323 P glucose import
GO:0046627 P negative regulation of insulin receptor signaling pathway
GO:0047485 F protein N-terminus binding
GO:0048471 C perinuclear region of cytoplasm
GO:0050808 P synapse organization
GO:0050821 P protein stabilization
GO:0051087 F chaperone binding
GO:0051291 P protein heterooligomerization
GO:0051492 P regulation of stress fiber assembly
GO:0051726 P regulation of cell cycle
GO:0051893 P regulation of focal adhesion assembly
GO:0051894 P positive regulation of focal adhesion assembly
GO:0055007 P cardiac muscle cell differentiation
GO:0090630 P activation of GTPase activity
GO:0090650 P cellular response to oxygen-glucose deprivation
GO:1901214 P regulation of neuron death
RNA-seq EntryA_ErmoMG_comp35866_c0_seq1
Sequence
(Amino Acid)
MSSVCEAGEVFALLEGGAEGARATGDALCALYGTVREPWLIRTLLVYHARTGSTRVLDVL
ARAPEPHAKHLLDQLHEQVRADRPARHQALAAIAPLVARRPPWLHRLPDHPLARDLVRVA
LRETDALPLLHVLLTLAALLPAAPALASSYPQDLAETLLRPAHLEPCLSPPTRAHLQLAQ
LALFRAIYATHPCTLLKMLRDYGSKLNVGAAKAAWERAVTSLASSVRLHPAILMGSQNQE
ADTIRWARREIHDVVAETRRLSIPVRDDPAPSPQPILLPAVPVVLSPVPGSGAHAARAAS
ALRPGAEPWFPLADRCGGDSAPSTPLPADADTGEPPEAAVEATPENTPARDTRAQFRFPM
DSGAVRAIGRKSRGASSPPRKETSPAGDAYSSRLARVMQERRAVDSPVLFSGTQPSAGVA
RPEPNRPAPLVDTEPYNVEDREVLELTRCADVEEEWTEGGGANERAIVLDARRRARSPVR
GAGGAGGARGASHRTASCDRDVGTTRRTIAVQTVDVWPEPYEFIIADFYRSLPDESTRQG
EPSVPCERLEAYLADLYAGRNCSGAGDDQVPLLHAQLMYERWRREVHAERNRRLLGRCRQ
VRALELRIQALAERVRALTRERDELRACAVREPPPAPP
(211 a.a.)

- SilkBase 1999-2023 -