| Name | O_ErmoMG11175_complete:A_ErmoMG_comp35800_c0_seq4 |
| Scaffold_id | |
NCBI non-redundant
(nr) | Ribosomal_protein_S6_kinase,_partial_[Operophtera_brumata] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0002119 |
P |
nematode larval development |
| GO:0004672 |
F |
protein kinase activity |
| GO:0004674 |
F |
protein serine/threonine kinase activity |
| GO:0004711 |
F |
ribosomal protein S6 kinase activity |
| GO:0005524 |
F |
ATP binding |
| GO:0005634 |
C |
nucleus |
| GO:0005737 |
C |
cytoplasm |
| GO:0006468 |
P |
protein phosphorylation |
| GO:0007165 |
P |
signal transduction |
| GO:0008340 |
P |
determination of adult lifespan |
| GO:0010628 |
P |
positive regulation of gene expression |
| GO:0016301 |
F |
kinase activity |
| GO:0016310 |
P |
phosphorylation |
| GO:0016740 |
F |
transferase activity |
| GO:0030424 |
C |
axon |
| GO:0035556 |
P |
intracellular signal transduction |
| GO:0042995 |
C |
cell projection |
| GO:0043204 |
C |
perikaryon |
| GO:0046872 |
F |
metal ion binding |
| GO:2000786 |
P |
positive regulation of autophagosome assembly |
|
| RNA-seq Entry | A_ErmoMG_comp35800_c0_seq4 |
Sequence
(Amino Acid) | MSSYMAGVFDLDLEVDTVTVADSDEDDIIDVDEVDYEPELHVNSIVETEGSETIQLCEDN
VNPGQCKRLGPQDFELRKVLGKGGYGKVFQVRKITGPDAGAHFAMKVLKKASIVRNQKDT
AHTKAERNILEAVKHPFIVELVYAFQTGGKLYLILEYLSGGELFMHLEREGIFLEDTA
*(58 a.a.) |
