SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG11104_internal:A_ErmoMG_comp35767_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_C-terminal-binding_protein_isoform_X1_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001700 P embryonic development via the syncytial blastoderm
GO:0003713 F transcription coactivator activity
GO:0003714 F transcription corepressor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005700 C polytene chromosome
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0008022 F protein C-terminus binding
GO:0008134 F transcription factor binding
GO:0008152 P metabolic process
GO:0016055 P Wnt signaling pathway
GO:0016360 P sensory organ precursor cell fate determination
GO:0016491 F oxidoreductase activity
GO:0016616 F oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0019233 P sensory perception of pain
GO:0022416 P chaeta development
GO:0030111 P regulation of Wnt signaling pathway
GO:0031010 C ISWI-type complex
GO:0035220 P wing disc development
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0043044 P chromatin remodeling
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046427 P positive regulation of receptor signaling pathway via JAK-STAT
GO:0051287 F NAD binding
GO:0055114 P obsolete oxidation-reduction process
GO:0070491 F DNA-binding transcription factor binding
RNA-seq EntryA_ErmoMG_comp35767_c1_seq1
Sequence
(Amino Acid)
FNVFQQGPLKDAPNLLCTPHAAFYSDASAQELREMAASEIRRAIVGRIPECLRNCVNKDY
FLGGSGVGGGVVGGVVGGVVGGVVSGSGGGGGAYGEGINGSYYGAAQAAHSTTAVHEPPP
HPPAHP
(41 a.a.)

- SilkBase 1999-2023 -