SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG11024_internal:A_ErmoMG_comp35740_c2_seq2
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_puff-specific_protein_Bx42_[Plutella_xylostella]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000398 P mRNA splicing, via spliceosome
GO:0003713 F transcription coactivator activity
GO:0003714 F transcription corepressor activity
GO:0005112 F Notch binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005681 C spliceosomal complex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006397 P mRNA processing
GO:0007219 P Notch signaling pathway
GO:0008024 C cyclin/CDK positive transcription elongation factor complex
GO:0008380 P RNA splicing
GO:0016363 C nuclear matrix
GO:0030511 P positive regulation of transforming growth factor beta receptor signaling pathway
GO:0035257 F nuclear receptor binding
GO:0035914 P skeletal muscle cell differentiation
GO:0042771 P intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0042809 F vitamin D receptor binding
GO:0042974 F retinoic acid receptor binding
GO:0043923 P positive regulation by host of viral transcription
GO:0044822 F RNA binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046332 F SMAD binding
GO:0048026 P positive regulation of mRNA splicing, via spliceosome
GO:0048384 P retinoic acid receptor signaling pathway
GO:0048385 P regulation of retinoic acid receptor signaling pathway
GO:0050769 P positive regulation of neurogenesis
GO:0051571 P positive regulation of histone H3-K4 methylation
GO:0070562 P regulation of vitamin D receptor signaling pathway
GO:0070564 P positive regulation of vitamin D receptor signaling pathway
GO:0071013 C catalytic step 2 spliceosome
GO:0071146 C heteromeric SMAD protein complex
GO:0071300 P cellular response to retinoic acid
RNA-seq EntryA_ErmoMG_comp35740_c2_seq2
Sequence
(Amino Acid)
SLSSLLPAPSQQVWDRDDDLKSKRLGSALVVSQSNVPPYGERKGWVPRKEDDFADGGAFP
EIHVAQYPLGMGMRGKESTSNALAVQLDESGRVKYSAIARQGHSADKIIYSKLTDLLPAE
VLAEDDPGLQKPDEDDIQEITEKTKLALEKLTNAKISAAMPVKAAPKAAPAQYIRYTPAQ
QGGSYNS
(61 a.a.)

- SilkBase 1999-2023 -