SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG10984_3prime_partial:A_ErmoMG_comp35725_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_ATP-dependent_RNA_helicase_dbp2-like_isoform_X2_[Papilio_polytes]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000166 F nucleotide binding
GO:0000381 P regulation of alternative mRNA splicing, via spliceosome
GO:0000398 P mRNA splicing, via spliceosome
GO:0003676 F nucleic acid binding
GO:0003712 F transcription coregulator activity
GO:0003713 F transcription coactivator activity
GO:0003723 F RNA binding
GO:0003724 F RNA helicase activity
GO:0004004 F RNA helicase activity
GO:0004386 F helicase activity
GO:0005515 F protein binding
GO:0005516 F calmodulin binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005681 C spliceosomal complex
GO:0005730 C nucleolus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006397 P mRNA processing
GO:0008380 P RNA splicing
GO:0009299 P mRNA transcription
GO:0010501 P RNA secondary structure unwinding
GO:0016020 C membrane
GO:0016049 P cell growth
GO:0016787 F hydrolase activity
GO:0016818 F hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0019899 F enzyme binding
GO:0030331 F estrogen receptor binding
GO:0030529 C ribonucleoprotein complex
GO:0033148 P positive regulation of intracellular estrogen receptor signaling pathway
GO:0036002 F pre-mRNA binding
GO:0043517 P positive regulation of DNA damage response, signal transduction by p53 class mediator
GO:0044822 F RNA binding
GO:0045069 P regulation of viral genome replication
GO:0045667 P regulation of osteoblast differentiation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048306 F calcium-dependent protein binding
GO:0048511 P rhythmic process
GO:0050681 F androgen receptor binding
GO:0060765 P regulation of androgen receptor signaling pathway
GO:0070062 C extracellular exosome
GO:0071013 C catalytic step 2 spliceosome
GO:0072332 P intrinsic apoptotic signaling pathway by p53 class mediator
GO:2001014 P regulation of skeletal muscle cell differentiation
RNA-seq EntryA_ErmoMG_comp35725_c0_seq1
Sequence
(Amino Acid)
MYDDRRGGRGGRGGGRGGRGSSRGRGSDRSEDRGSSRFGGRDGGHGGRDGGRGFGRSGDR
GSFKNDQPGGNLRKIRWDTVELTPFQKNFYVPHPNVERRTQTEIESYRSQHQITVNGRDV
PAPSIYFEEGGFPDYAMKEILKQGFPNPTPIQAQGWPIALSGRDMVGIAQTGSGKTLAYI
LPAIVHILNQPRLLRDDGPIVLVLAPTRELAQQIQQVANDFGQSIQV
(74 a.a.)

- SilkBase 1999-2023 -