SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG10858_complete:A_ErmoMG_comp35677_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_glycogen_synthase_kinase-3_beta_isoform_X1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001837 P epithelial to mesenchymal transition
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005886 C plasma membrane
GO:0005975 P carbohydrate metabolic process
GO:0005977 P glycogen metabolic process
GO:0006468 P protein phosphorylation
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007623 P circadian rhythm
GO:0009968 P negative regulation of signal transduction
GO:0016020 C membrane
GO:0016055 P Wnt signaling pathway
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0030154 P cell differentiation
GO:0032092 P positive regulation of protein binding
GO:0032886 P regulation of microtubule-based process
GO:0036016 P cellular response to interleukin-3
GO:0048511 P rhythmic process
GO:0050321 F tau-protein kinase activity
GO:0051534 P negative regulation of calcineurin-NFAT signaling cascade
GO:0097192 P extrinsic apoptotic signaling pathway in absence of ligand
GO:1901030 P positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway
RNA-seq EntryA_ErmoMG_comp35677_c0_seq2
Sequence
(Amino Acid)
MKLIGNGSFGVVYQAKLCDTGELIAIKKVLQDKRFKNRELQIMRRLEHCNIVKLKYFFYS
SGEKKDEVYLNLVLEYIPETVYKVARHYSKDEQTIPISFIKLYMYQLFRSLAYIHSLGIC
HRDIKPQNLLLDPKTGVLKLCDFGSAKHLVRGEPNVSYICSRYYRAPELIFGATDYTTKI
DVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKS
HPWAKVFRACTPPDAISLVSRLLEYTPGARLSPLQACVHSFFDELREPTARLPNGRPLPP
LFNFTEYELGIQPSLNEFLKPRQGAQPEPASASAAPEHDAPGGEAASSGATAEAS
*(117 a.a.)

- SilkBase 1999-2023 -