SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG10852_internal:A_ErmoMG_comp35673_c1_seq2
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_zinc_finger_homeobox_protein_3_[Amyelois_transitella]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001046 F core promoter sequence-specific DNA binding
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007517 P muscle organ development
GO:0008270 F zinc ion binding
GO:0016604 C nuclear body
GO:0019899 F enzyme binding
GO:0032922 P circadian regulation of gene expression
GO:0043231 C intracellular membrane-bounded organelle
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045662 P negative regulation of myoblast differentiation
GO:0045663 P positive regulation of myoblast differentiation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0071559 P response to transforming growth factor beta
GO:1904059 P regulation of locomotor rhythm
RNA-seq EntryA_ErmoMG_comp35673_c1_seq2
Sequence
(Amino Acid)
SYNDPNRKYKCHRCKVAFTRQSYLTAHNKTLLHRKGEKLTYPMEKYLDPNRPFKCDVCKE
SFTQKNILLVHYNSVSHLHKLKRAMQEQQNNNNPPVSPGAGSAPSNLTLTPKSTSSEEDD
RKRYKCNICKVAYTQGSNLDIHMRSV
(47 a.a.)

- SilkBase 1999-2023 -