SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG10757_3prime_partial:A_ErmoMG_comp35633_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_LOW_QUALITY_PROTEIN:_tuberin_[Bombyx_mori]
Ontology
GO:0005096 F GTPase activator activity
GO:0005515 F protein binding
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005901 C caveola
GO:0007165 P signal transduction
GO:0019902 F phosphatase binding
GO:0030030 P cell projection organization
GO:0030178 P negative regulation of Wnt signaling pathway
GO:0030425 C dendrite
GO:0030426 C growth cone
GO:0032007 P negative regulation of TOR signaling
GO:0033596 C TSC1-TSC2 complex
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043231 C intracellular membrane-bounded organelle
GO:0043234 C protein-containing complex
GO:0043407 P negative regulation of MAP kinase activity
GO:0043547 P positive regulation of GTPase activity
GO:0045121 C membrane raft
GO:0045184 P establishment of protein localization
GO:0045792 P negative regulation of cell size
GO:0046627 P negative regulation of insulin receptor signaling pathway
GO:0046982 F protein heterodimerization activity
GO:0048471 C perinuclear region of cytoplasm
GO:0050680 P negative regulation of epithelial cell proliferation
GO:0051056 P regulation of small GTPase mediated signal transduction
GO:0051260 P protein homooligomerization
GO:0051291 P protein heterooligomerization
GO:0051726 P regulation of cell cycle
GO:0051898 P negative regulation of protein kinase B signaling
RNA-seq EntryA_ErmoMG_comp35633_c0_seq2
Sequence
(Amino Acid)
MGSRDRDSSKSLQDKLKVFFKKGPSAPLAVRNDLISKELLVELSAETPLHRRLRAMKELG
DKIIHGRVEEGGVEKLWSCTKDLLYLENNTEARHTALGFMRCIAEGQADDLQIMRTTFFN
FLKETHPSHNTEDYQLRFKLLYTLTNSGKNITCFELDIGQFLLQWLPQIQAPTNTVEFLQ
LIVNVVK
(61 a.a.)

- SilkBase 1999-2023 -