| Name | O_ErmoMG10596_3prime_partial:A_ErmoMG_comp35570_c0_seq1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | PREDICTED:_glutathione_synthetase-like_isoform_X2_[Amyelois_transitella] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0000287 |
F |
magnesium ion binding |
| GO:0004363 |
F |
glutathione synthase activity |
| GO:0005524 |
F |
ATP binding |
| GO:0006750 |
P |
glutathione biosynthetic process |
| GO:0007568 |
P |
aging |
| GO:0009410 |
P |
response to xenobiotic stimulus |
| GO:0016594 |
F |
glycine binding |
| GO:0016874 |
F |
ligase activity |
| GO:0031667 |
P |
response to nutrient levels |
| GO:0034612 |
P |
response to tumor necrosis factor |
| GO:0042277 |
F |
peptide binding |
| GO:0042803 |
F |
protein homodimerization activity |
| GO:0043200 |
P |
response to amino acid |
| GO:0043295 |
F |
glutathione binding |
| GO:0046686 |
P |
response to cadmium ion |
| GO:0046872 |
F |
metal ion binding |
| GO:0070062 |
C |
extracellular exosome |
|
| RNA-seq Entry | A_ErmoMG_comp35570_c0_seq1 |
Sequence
(Amino Acid) | MSQARLAPCLQLPVENKILVNVIEKAKDWALMHGVGMRDKKHFNKDVIQIAPFILLPSPF
PRTEFTKAIELQPVLNELMHKVAHDDEFLEKTLQNALQVDEFTASLYDIWVKVRKEGISQ
IMCGLADIARYAAFRHHAGAP
(46 a.a.) |
