SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG10554_complete:A_ErmoMG_comp35551_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)		Der1-like_domain_family_member_1_[Bombyx_mori]
Ontology
GO:0002020 F protease binding
GO:0004872 F signaling receptor activity
GO:0005515 F protein binding
GO:0005769 C early endosome
GO:0005770 C late endosome
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0006810 P transport
GO:0006986 P response to unfolded protein
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016032 P viral process
GO:0019060 P intracellular transport of viral protein in host cell
GO:0030176 C integral component of endoplasmic reticulum membrane
GO:0030433 P ubiquitin-dependent ERAD pathway
GO:0030968 P endoplasmic reticulum unfolded protein response
GO:0030970 P retrograde protein transport, ER to cytosol
GO:0031398 P positive regulation of protein ubiquitination
GO:0031625 F ubiquitin protein ligase binding
GO:0031648 P protein destabilization
GO:0032092 P positive regulation of protein binding
GO:0034098 C VCP-NPL4-UFD1 AAA ATPase complex
GO:0034620 P cellular response to unfolded protein
GO:0036502 C Derlin-1-VIMP complex
GO:0036503 P ERAD pathway
GO:0036513 C Derlin-1 retrotranslocation complex
GO:0042288 F MHC class I protein binding
GO:0043657 C host cell
GO:0045184 P establishment of protein localization
GO:0051117 F ATPase binding
GO:0051260 P protein homooligomerization
GO:0071712 P ER-associated misfolded protein catabolic process
GO:1990381 F ubiquitin-specific protease binding
RNA-seq EntryA_ErmoMG_comp35551_c0_seq3
Sequence
(Amino Acid)
MSEFHDWYNSVPYFTRYWFTFTVVLSLVGKLGLISPYYLILDSTYFFNDFQIWRPLTAAF
YYPIHPGTGFHFLTNCYFLYNYSKRLETGMFAGKPADYFYMLLFNWVCCVVMGLLVKLRV
LMDPMVLSVVYVWCQLNKDIIVSFWFGTKFKAMYLPWVLLAFNIVINGGGLEELLGILIG
HLAFFLLFKYPQEFGGPALLTPPVFLKQMFPDTRYVGGFGTAPQARVAATGPGNNVFGGH
NWGRGQTLGGN
*(83 a.a.)

- SilkBase 1999-2023 -