SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG10510_complete:A_ErmoMG_comp35524_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_dynein_heavy_chain,_cytoplasmic_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000776 C kinetochore
GO:0003774 F cytoskeletal motor activity
GO:0003777 F microtubule motor activity
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005794 C Golgi apparatus
GO:0005856 C cytoskeleton
GO:0005868 C cytoplasmic dynein complex
GO:0005874 C microtubule
GO:0005875 C microtubule associated complex
GO:0005938 C cell cortex
GO:0006886 P intracellular protein transport
GO:0007018 P microtubule-based movement
GO:0007051 P spindle organization
GO:0007052 P mitotic spindle organization
GO:0007067 P mitotic cell cycle
GO:0007098 P centrosome cycle
GO:0007279 P pole cell formation
GO:0007282 P cystoblast division
GO:0007294 P germarium-derived oocyte fate determination
GO:0007298 P border follicle cell migration
GO:0007301 P female germline ring canal formation
GO:0007312 P oocyte nucleus migration involved in oocyte dorsal/ventral axis specification
GO:0007349 P cellularization
GO:0007405 P neuroblast proliferation
GO:0008088 P axo-dendritic transport
GO:0008090 P retrograde axonal transport
GO:0008298 P intracellular mRNA localization
GO:0008569 F minus-end-directed microtubule motor activity
GO:0016319 P mushroom body development
GO:0016887 F ATP hydrolysis activity
GO:0030071 P regulation of mitotic metaphase/anaphase transition
GO:0030286 C dynein complex
GO:0030529 C ribonucleoprotein complex
GO:0030723 P ovarian fusome organization
GO:0034063 P stress granule assembly
GO:0034501 P protein localization to kinetochore
GO:0035011 P melanotic encapsulation of foreign target
GO:0040001 P establishment of mitotic spindle localization
GO:0040003 P chitin-based cuticle development
GO:0042623 F ATP hydrolysis activity
GO:0043005 C neuron projection
GO:0045169 C fusome
GO:0045172 C germline ring canal
GO:0045197 P establishment or maintenance of epithelial cell apical/basal polarity
GO:0045198 P establishment of epithelial cell apical/basal polarity
GO:0045478 P fusome organization
GO:0045505 F dynein intermediate chain binding
GO:0046604 P positive regulation of mitotic centrosome separation
GO:0047497 P mitochondrion transport along microtubule
GO:0048134 P germ-line cyst formation
GO:0048311 P mitochondrion distribution
GO:0048477 P oogenesis
GO:0048813 P dendrite morphogenesis
GO:0050658 P RNA transport
GO:0051237 P maintenance of RNA location
GO:0051642 P centrosome localization
GO:0051683 P establishment of Golgi localization
GO:0051959 F dynein light intermediate chain binding
GO:1904115 C axon cytoplasm
GO:1904801 P positive regulation of neuron remodeling
RNA-seq EntryA_ErmoMG_comp35524_c0_seq1
Sequence
(Amino Acid)
MEFVCQIVLRSISGSYHDGQTPSWLGLPNNAEKVLLTTQGSDLVSKLLKMQQLEDEEELA
YSAATQDHDANSVVLGDGRPAWMKILHQTAANWLQLLPKELPTLRRTVENIKDPLYRFFE
REVAAGASLLQQVLHDLRNVMSICQSEMKQTNETRAMVGSLVRGMLPASWRRYAVARGCT
VQQWIGDFAQRVTQLAEVSDAVAAKRLQNVPVWLGGLLNPEAYITATRQCVAQANSWSLE
ELHLQVTIPDPGTPTENAQTEWSFSVTGLKLQGATVKGNRLLLTNTIMVDLPLTVLTWVR
GPEPASSTHTLTLPVYLNSARTELLFTVRLPVAPGQDAHAFYERGVALLTSTALN
*(117 a.a.)

- SilkBase 1999-2023 -