SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG10478_3prime_partial:A_ErmoMG_comp35509_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_regulator_of_G-protein_signaling_loco_[Bombyx_mori]
Ontology
GO:0000578 P embryonic axis specification
GO:0001965 F G-protein alpha-subunit binding
GO:0003015 P heart process
GO:0005057 F obsolete signal transducer activity, downstream of receptor
GO:0005092 F GDP-dissociation inhibitor activity
GO:0005096 F GTPase activator activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006979 P response to oxidative stress
GO:0007049 P cell cycle
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0007303 P cytoplasmic transport, nurse cell to oocyte
GO:0007310 P oocyte dorsal/ventral axis specification
GO:0007419 P ventral cord development
GO:0008069 P dorsal/ventral axis specification, ovarian follicular epithelium
GO:0008105 P protein localization
GO:0008277 P regulation of G protein-coupled receptor signaling pathway
GO:0009408 P response to heat
GO:0009786 P regulation of asymmetric cell division
GO:0010001 P glial cell differentiation
GO:0014045 P establishment of endothelial blood-brain barrier
GO:0016020 C membrane
GO:0016324 C apical plasma membrane
GO:0019991 P septate junction assembly
GO:0030154 P cell differentiation
GO:0030695 F GTPase regulator activity
GO:0030866 P cortical actin cytoskeleton organization
GO:0032291 P axon ensheathment in central nervous system
GO:0042594 P response to starvation
GO:0043547 P positive regulation of GTPase activity
GO:0045179 C apical cortex
GO:0048477 P oogenesis
GO:0050790 P regulation of catalytic activity
GO:0050832 P defense response to fungus
GO:0051301 P cell division
GO:0055059 P asymmetric neuroblast division
GO:0060857 P establishment of glial blood-brain barrier
RNA-seq EntryA_ErmoMG_comp35509_c0_seq1
Sequence
(Amino Acid)
MARLATSAVQFCQRLQELYPQKLHLTTKQSEQSSPFRRWTTGSGASSSYRHHDHRNMYNK
QMSEGSTPMSSGSGGSKVASWSLGLEQLLADPSGAAAFEHFLSNEFAAENIRFWWLCEQY
RATTEESERVELAGQIWHSHLADTAPEPVNVDAPARRHAALMMHHRPPPHDLFLQAQKQI
FNVLKFDSYHRFLRSAQHAECARAELRGLPPPYPPQHNNKLKKSASSVSDRRRSGGGSLL
SWRRPGSRDRDTHTNHDVVKSQTAVSQSSLCRVVLPDGATSVVSVDAAVSVGRVVDRLLQ
KRNLPCPNYDVIVEDQKSGRVLDRSAPSVLAGGCVVRRI
(112 a.a.)

- SilkBase 1999-2023 -