SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG10396_3prime_partial:A_ErmoMG_comp35471_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_endoribonuclease_Dcr-1_[Papilio_polytes]
Ontology
GO:0000166 F nucleotide binding
GO:0003723 F RNA binding
GO:0003725 F double-stranded RNA binding
GO:0003727 F single-stranded RNA binding
GO:0004386 F helicase activity
GO:0004518 F nuclease activity
GO:0004519 F endonuclease activity
GO:0004525 F ribonuclease III activity
GO:0004530 F deoxyribonuclease I activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006309 P apoptotic DNA fragmentation
GO:0006396 P RNA processing
GO:0007279 P pole cell formation
GO:0007294 P germarium-derived oocyte fate determination
GO:0007367 P segment polarity determination
GO:0016246 P RNA interference
GO:0016442 C RISC complex
GO:0016443 F bidentate ribonuclease III activity
GO:0016787 F hydrolase activity
GO:0016891 F endoribonuclease activity, producing 5'-phosphomonoesters
GO:0030422 P production of siRNA involved in RNA interference
GO:0030727 P germarium-derived female germ-line cyst formation
GO:0031047 P gene silencing by RNA
GO:0031054 P pre-miRNA processing
GO:0033227 P dsRNA transport
GO:0035087 P siRNA loading onto RISC involved in RNA interference
GO:0035196 P production of miRNAs involved in gene silencing by miRNA
GO:0042078 P germ-line stem cell division
GO:0042594 P response to starvation
GO:0045448 P mitotic cell cycle, embryonic
GO:0046872 F metal ion binding
GO:0048813 P dendrite morphogenesis
GO:0070883 F pre-miRNA binding
GO:0090501 P RNA phosphodiester bond hydrolysis
GO:0090502 P RNA phosphodiester bond hydrolysis, endonucleolytic
RNA-seq EntryA_ErmoMG_comp35471_c0_seq2
Sequence
(Amino Acid)
MYSTAAVPELCRAHPFAAPLWAATVALPCALYRINALLIAEEIRRAVAADVGLGVPRPRV
RPPPLDFGWSLAEVLSADAEKNEKKKDEDTIKELKDKESTGNEDDSGTEEKDKDSETDEK
MEKEETETKTINDILQEKEDAENGFEIGTWSNEMASCIPADTDYDDYLEPLPPNLTFCTS
GSGGAKWCDPVQKPKNEFNPSRSYSVADSDCSYISSDFDTEDSD
(73 a.a.)

- SilkBase 1999-2023 -