SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG10322_internal:A_ErmoMG_comp35445_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_activin_receptor_type-1_[Amyelois_transitella]
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000166 F nucleotide binding
GO:0001569 P branching involved in blood vessel morphogenesis
GO:0001701 P in utero embryonic development
GO:0001702 P gastrulation with mouth forming second
GO:0001707 P mesoderm formation
GO:0001755 P neural crest cell migration
GO:0002526 P acute inflammatory response
GO:0003143 P embryonic heart tube morphogenesis
GO:0003183 P mitral valve morphogenesis
GO:0003289 P atrial septum primum morphogenesis
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004675 F transmembrane receptor protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0005025 F transforming growth factor beta receptor activity, type I
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005887 C integral component of plasma membrane
GO:0006468 P protein phosphorylation
GO:0007178 P transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0007281 P germ cell development
GO:0007368 P determination of left/right symmetry
GO:0007369 P gastrulation
GO:0007498 P mesoderm development
GO:0007507 P heart development
GO:0009968 P negative regulation of signal transduction
GO:0010862 P positive regulation of pathway-restricted SMAD protein phosphorylation
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016361 F activin receptor activity, type I
GO:0016740 F transferase activity
GO:0017046 F peptide hormone binding
GO:0018107 P peptidyl-threonine phosphorylation
GO:0019838 F growth factor binding
GO:0023014 P signal transduction
GO:0030278 P regulation of ossification
GO:0030335 P positive regulation of cell migration
GO:0030501 P positive regulation of bone mineralization
GO:0030509 P BMP signaling pathway
GO:0032924 P activin receptor signaling pathway
GO:0032926 P negative regulation of activin receptor signaling pathway
GO:0042803 F protein homodimerization activity
GO:0045177 C apical part of cell
GO:0045669 P positive regulation of osteoblast differentiation
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046332 F SMAD binding
GO:0046872 F metal ion binding
GO:0048179 C activin receptor complex
GO:0048185 F activin binding
GO:0050431 F transforming growth factor beta binding
GO:0051145 P smooth muscle cell differentiation
GO:0060037 P pharyngeal system development
GO:0060389 P pathway-restricted SMAD protein phosphorylation
GO:0060923 P cardiac muscle cell fate commitment
GO:0061445 P endocardial cushion cell fate commitment
GO:0071385 P cellular response to glucocorticoid stimulus
GO:0071773 P cellular response to BMP stimulus
GO:2000017 P positive regulation of determination of dorsal identity
GO:2001237 P negative regulation of extrinsic apoptotic signaling pathway
RNA-seq EntryA_ErmoMG_comp35445_c0_seq1
Sequence
(Amino Acid)
NLDGLVDDGQGRILQHLDDPIMLEKMKVHTPRYKCHFCEHPDCDTGQHSICENAPSCFKS
SVREYNGELQHSRGCTHNNDHYQFICPHKNQGVKKRHTSQLNVTCCVGDLCNSGEFPTLW
EAARPRTGWELWAGGALAILVIAGLLTGLLILLNRVNRMRVSSTALQKLCTEAKYFPSNV
YNQHLTNGYYEGTEGSQGGCVAVAAGDSTLREFLEGSLSSGSGSGLPLMVQRTLAKQVTL
YDCVGKGRYGEVWRGSWYGDSVAVKIFFSRDEASWKRETEIYSTVLLRHDNILAYVGSDM
TSRGSCTQLWLITQYHPLGSLHEHLQRGTVSRQQMVALCLSAASGLLHLHTQIHGTQGKP
AIAHRDIKSKNILVKVNGECCIGDLGLAVTAQHLQGGALQHNPRQGTKRYMSPEMLDHTL
VADSLEAYLRCDVYSLALVLWEVCRR
(147 a.a.)

- SilkBase 1999-2023 -