SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG10260_5prime_partial:A_ErmoMG_comp35409_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_potassium_channel_subfamily_K_member_1-like_[Amyelois_transitella]
Ontology
GO:0003073 P regulation of systemic arterial blood pressure
GO:0003085 P negative regulation of systemic arterial blood pressure
GO:0005242 F inward rectifier potassium channel activity
GO:0005244 F voltage-gated ion channel activity
GO:0005267 F potassium channel activity
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006813 P potassium ion transport
GO:0008076 C voltage-gated potassium channel complex
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0022841 F potassium ion leak channel activity
GO:0030322 P stabilization of membrane potential
GO:0034765 P regulation of ion transmembrane transport
GO:0060075 P regulation of resting membrane potential
GO:0061337 P cardiac conduction
GO:0071805 P potassium ion transmembrane transport
RNA-seq EntryA_ErmoMG_comp35409_c1_seq1
Sequence
(Amino Acid)
TTVGLGDYIPGDSPGQPYRPIYKIATIFYLIIGLTFLMLTLTVFYDIPQLNLSSVFSSIK
LDEDPEKMRLSGSGAVPGYGLGGLVMRDDYCRDQRRSVVHIRPHLDDSPSPDDTTPVHAR
DMRIP
*(41 a.a.)

- SilkBase 1999-2023 -