| Name | O_ErmoMG10170_complete:A_ErmoMG_comp35371_c0_seq1 |
| Scaffold_id | |
NCBI non-redundant (nr) | proteasome_subunit_alpha_type_6-A_[Bombyx_mori] |
| Ontology |
| GO:0000502 |
C |
proteasome complex |
| GO:0000932 |
C |
P-body |
| GO:0003723 |
F |
RNA binding |
| GO:0004175 |
F |
endopeptidase activity |
| GO:0004298 |
F |
threonine-type endopeptidase activity |
| GO:0005634 |
C |
nucleus |
| GO:0005737 |
C |
cytoplasm |
| GO:0005839 |
C |
proteasome core complex |
| GO:0005844 |
C |
polysome |
| GO:0006508 |
P |
proteolysis |
| GO:0006511 |
P |
ubiquitin-dependent protein catabolic process |
| GO:0008233 |
F |
peptidase activity |
| GO:0016363 |
C |
nuclear matrix |
| GO:0016787 |
F |
hydrolase activity |
| GO:0019773 |
C |
proteasome core complex, alpha-subunit complex |
| GO:0030016 |
C |
myofibril |
| GO:0030017 |
C |
sarcomere |
| GO:0051092 |
P |
positive regulation of NF-kappaB transcription factor activity |
| GO:0051603 |
P |
proteolysis involved in cellular protein catabolic process |
|
| RNA-seq Entry | A_ErmoMG_comp35371_c0_seq1 |
Sequence (Amino Acid) | MARESSAGFDRHITIFSPEGRLYQVEYALKAINQGGLTSVALRGTDAAVVAAQRKVPDRL
LDPASVTHLFPLTDRIGCVMTGMIADSRSQVQRARYEAANWQYKFGTEIPVHILCRRIAD
ISQVYTQNAEMRPLGCSMMLIAHDDESGPCVYKTDPSGYYCSYKAVAAGAKTVDANAYLE
KKLKKRSDLGTDDAVQLAISCLSQVLSVDFKSSEIEIGIVTKDDPKFRVLTESEIDRHLT
ALAEKD
*(81 a.a.) |