SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG10065_5prime_partial:A_ErmoMG_comp35318_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)		glucose_transporter_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0001939 C female pronucleus
GO:0005215 F transporter activity
GO:0005355 F glucose transmembrane transporter activity
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005901 C caveola
GO:0005911 C cell-cell junction
GO:0005989 P lactose biosynthetic process
GO:0006461 P protein-containing complex assembly
GO:0006810 P transport
GO:0006970 P response to osmotic stress
GO:0008643 P carbohydrate transport
GO:0015758 P glucose transmembrane transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016323 C basolateral plasma membrane
GO:0016324 C apical plasma membrane
GO:0019852 P L-ascorbic acid metabolic process
GO:0019900 F kinase binding
GO:0022857 F transmembrane transporter activity
GO:0022891 F transmembrane transporter activity
GO:0030496 C midbody
GO:0030864 C cortical actin cytoskeleton
GO:0031982 C vesicle
GO:0033300 F dehydroascorbic acid transmembrane transporter activity
GO:0042149 P cellular response to glucose starvation
GO:0042470 C melanosome
GO:0042802 F identical protein binding
GO:0042908 P xenobiotic transport
GO:0042910 F xenobiotic transmembrane transporter activity
GO:0043621 F protein self-association
GO:0045121 C membrane raft
GO:0050796 P regulation of insulin secretion
GO:0055056 F D-glucose transmembrane transporter activity
GO:0055085 P transmembrane transport
GO:0070062 C extracellular exosome
GO:0070837 P dehydroascorbic acid transport
GO:0072562 C blood microparticle
GO:1904659 P glucose transmembrane transport
RNA-seq EntryA_ErmoMG_comp35318_c0_seq2
Sequence
(Amino Acid)
APLYLSEISPVAIRGSVGTVYQLVITMTILLSQVLGLSNVLGTRDGWPWLFAVTVIPAVI
QCITLPMCPESPKYLLLNQGRELHAQRALNWLRGDIAVHGEMEEMHQEAEKNKISKKVTL
RELFSNRQLRRPLVIAIVVMIAQQLSGINAVIYFSTEIFRKAHLEDEAARYATLGMGAMN
VVMTVVSLVLVETAGRKTLLLTGFSGMFLCTVGITVAMSFTGYVWLSYLCIALVILFVVT
FAVGPGSIPWFLVTELFNQSSRPAASSVAVTVNWSANFLVGLSFLPLSYALGNNVFIIFG
VLQFLFILFIYTNVPETKNKTVEEITAMFRQHM
*(110 a.a.)

- SilkBase 1999-2023 -