EntryView

ORF from Assembled RNA_seq Entry

Name

O_ErmoMG10049_5prime_partial:A_ErmoMG_comp35312_c0_seq3

Scaffold_id

NCBI non-redundant
(nr)

PREDICTED:_developmental_protein_eyes_absent_[Bombyx_mori]

Ontology

GO:0001744	P	insect visual primordium formation
GO:0001746	P	Bolwig's organ morphogenesis
GO:0004721	F	phosphoprotein phosphatase activity
GO:0004725	F	protein tyrosine phosphatase activity
GO:0005634	C	nucleus
GO:0005737	C	cytoplasm
GO:0006351	P	transcription, DNA-templated
GO:0006355	P	regulation of transcription, DNA-templated
GO:0006470	P	protein dephosphorylation
GO:0007275	P	multicellular organism development
GO:0007280	P	pole cell migration
GO:0007283	P	spermatogenesis
GO:0007411	P	axon guidance
GO:0007419	P	ventral cord development
GO:0007435	P	salivary gland morphogenesis
GO:0007455	P	eye-antennal disc morphogenesis
GO:0007498	P	mesoderm development
GO:0007526	P	larval somatic muscle development
GO:0008134	F	transcription factor binding
GO:0008406	P	gonad development
GO:0008584	P	male gonad development
GO:0009416	P	response to light stimulus
GO:0009996	P	negative regulation of cell fate specification
GO:0010628	P	positive regulation of gene expression
GO:0016787	F	hydrolase activity
GO:0030707	P	ovarian follicle cell development
GO:0030946	F	protein tyrosine phosphatase activity, metal-dependent
GO:0035335	P	peptidyl-tyrosine dephosphorylation
GO:0042051	P	compound eye photoreceptor development
GO:0042675	P	compound eye cone cell differentiation
GO:0045087	P	innate immune response
GO:0045944	P	positive regulation of transcription by RNA polymerase II
GO:0046872	F	metal ion binding
GO:0048749	P	compound eye development
GO:0070285	P	pigment cell development
GO:0072499	P	photoreceptor cell axon guidance

RNA-seq Entry

Sequence
(Amino Acid)

QLRAELEQATDNWLTLACKCLNMINSRENCVNVLVTTTQLVPALAKVLLFGLGGVFPIEN
IYSATKTGKETCFEKIKQRFGERCTYVVIGDGQDEEAAAKAKNYPFWRISSHSDIAALYN
ALDMGFL
*(41 a.a.)

- SilkBase 1999-2023 -