SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/06/10
 
NameO_ErmoMG10020_5prime_partial:A_ErmoMG_comp35299_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_neurofilament_heavy_polypeptide-like_isoform_X3_[Bombyx_mori]
Ontology
RNA-seq EntryA_ErmoMG_comp35299_c0_seq3
Sequence
(Amino Acid)
ALLRSHASNPNLLDFEKSDFVTKPTLQIPKPKPKMESGPVGVTLEQFMLEKQAEERRQIY
SERVLLGVRRDQRDARDQRPQRDLQTRLDSIVPDVIYGEVRAGSALQARALPPAPAPATA
THTNTNLNSTNLKPISVKGKDGYERLVYRGEEKPAWGRNHKVHSTQRGAAQSPRTRGNES
WGAEGGVSRLRLVFGDNQSGSRGEYPHLVCPPTFRPETYSLQHNNTHDTYTSQ
*(77 a.a.)

- SilkBase 1999-2022 -