SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/06/10
 
NameO_ErmoMG10005_internal:A_ErmoMG_comp35294_c0_seq9
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_dual_3',5'-cyclic-AMP_and_-GMP_phosphodiesterase_11_isoform_X3_[Bombyx_mori]
Ontology
GO:0004114 F 3',5'-cyclic-nucleotide phosphodiesterase activity
GO:0004115 F 3',5'-cyclic-AMP phosphodiesterase activity
GO:0005575 C cellular_component
GO:0005829 C cytosol
GO:0007165 P signal transduction
GO:0008081 F phosphoric diester hydrolase activity
GO:0016787 F hydrolase activity
GO:0046058 P cAMP metabolic process
GO:0046068 P cGMP metabolic process
GO:0046331 P lateral inhibition
GO:0046872 F metal ion binding
GO:0047555 F 3',5'-cyclic-GMP phosphodiesterase activity
RNA-seq EntryA_ErmoMG_comp35294_c0_seq9
Sequence
(Amino Acid)
VAESGEPVNIPDAYKDERFNHDIDQQTGYRTRSLLCMPIKDINGEVIGVAQVINKQSDGP
FTAYDEKVFSSYLQFCGIGLRNAQLYERSQLEVKRNQVLLDLARMVFEEQSTIEHMVLRI
LTHTQSLIRCQRVQVLLVHEASKGSFSRVFDLEADDDTDSPRTSPYESRFPINIGITGYV
ATTGETVNIADAYLDARFDPSVDEGTGFRHNTILCMAIKNSEGRIIGVIQLVNKFDDLLF
TKNDENFVEAFAIFCGMGIHNTHMYEKAITAMAKQSVTLDVLSYHASASMDEAQRLRSLR
IPSSAHFSLHELAFDDIKMTDDDTLTACLRMFLDMDFVERFHIDYAVLCRWLLSVKKNYR
NVTYHNWRHAFNVAQMMFAILTETQWWKIFGELECLALIIGCLCHDLDHRGTNNSFQIKA
SSPLAQLYSTSTMEHHHFDQCLMILNSPGNQILMNLSSDDYEKVVKVLEDAILSTDLAIY
FSKRKAFIELVNMDESVTPLWGECEERRGLLRAMLMTACDLAAITKPWPIERRVAGLVAG
EFFRQGDLERQNLNLTPIDIMNRDKEDQLPAMQVKFIDTICLPIYDEVSLLARRVLFIYR
DVL
(200 a.a.)

- SilkBase 1999-2022 -