SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK7313_complete:A_BomoSK_comp10505_c1_seq1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
PREDICTED:_cyclin-H_[Amyelois_transitella]
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000086 P G2/M transition of mitotic cell cycle
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005675 C transcription factor TFIIH holo complex
GO:0006283 P transcription-coupled nucleotide-excision repair
GO:0006294 P nucleotide-excision repair, preincision complex assembly
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006361 P transcription initiation from RNA polymerase I promoter
GO:0006362 P transcription elongation from RNA polymerase I promoter
GO:0006363 P termination of RNA polymerase I transcription
GO:0006366 P transcription by RNA polymerase II
GO:0006367 P transcription initiation from RNA polymerase II promoter
GO:0006368 P transcription elongation from RNA polymerase II promoter
GO:0006370 P 7-methylguanosine mRNA capping
GO:0006468 P protein phosphorylation
GO:0007049 P cell cycle
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0008353 F RNA polymerase II CTD heptapeptide repeat kinase activity
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016538 F cyclin-dependent protein serine/threonine kinase regulator activity
GO:0019907 C cyclin-dependent protein kinase activating kinase holoenzyme complex
GO:0045737 P positive regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0070985 C transcription factor TFIIK complex
GO:1901409 P positive regulation of phosphorylation of RNA polymerase II C-terminal domain
RNA-seq EntryA_BomoSK_comp10505_c1_seq1
Sequence
(Amino Acid)
MFSTSSQRKFWTFSDENELARLREKHNYFFYARQNSHIDEQQRFTYFLSPDEERQLLKQY
ELHLKEFCKRFTPPMPKGVVGTAFHYFKRFYLYNSTMDYHPKEILATCVYLACKVEEFNV
SIGQFVANIKGDREKASDIILNNELLLMQQLNYHLTIHNPFRPVEGFLIDIKTRCSLANP
ERLRSGIDEFLEKVFLTDACLLYAPSQIALAAVLHAASKEQENLDSYVTDILFRDAGRDK
LAILIEAVRKIRSLVKMVEAPARERVRLIEKKLDKCRNQENNPDSEIYKRRMRELLDEDD
VLHVGSSRMSLDTSGVTQVLSPSAS
*(107 a.a.)

- SilkBase 1999-2023 -