SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoSK7165_5prime_partial:A_BomoSK_comp10408_c2_seq1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)		PREDICTED:_TNF_receptor-associated_factor_4_isoform_X3_[Bombyx_mori]
Ontology
GO:0004842 F ubiquitin-protein transferase activity
GO:0005164 F tumor necrosis factor receptor binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005923 C bicellular tight junction
GO:0006915 P apoptotic process
GO:0007165 P signal transduction
GO:0007275 P multicellular organism development
GO:0007585 P respiratory gaseous exchange by respiratory system
GO:0008270 F zinc ion binding
GO:0016020 C membrane
GO:0016567 P protein ubiquitination
GO:0019901 F protein kinase binding
GO:0030054 C cell junction
GO:0030323 P respiratory tube development
GO:0031625 F ubiquitin protein ligase binding
GO:0031996 F thioesterase binding
GO:0042981 P regulation of apoptotic process
GO:0045860 P positive regulation of protein kinase activity
GO:0046330 P positive regulation of JNK cascade
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0050699 F WW domain binding
GO:0090073 P positive regulation of protein homodimerization activity
RNA-seq EntryA_BomoSK_comp10408_c2_seq1
Sequence
(Amino Acid)
SQYGYKLQASLFLNGNGAGESTHMSVYIKILPGEYDALLRWPFAHTVSFTLFDQSSSPDR
ACNIVESFVPDPTWKNFQRPSKEPDALGFGFPRFVSHEMLKKRNFVKDDIMFLRVKVDPS
KIVAV
*(41 a.a.)

- SilkBase 1999-2023 -