SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK7092_5prime_partial:A_BomoSK_comp10340_c1_seq1
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)
PREDICTED:_prestin_isoform_X2_[Bombyx_mori]
Ontology
GO:0002931 P response to ischemia
GO:0005254 F chloride channel activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007605 P sensory perception of sound
GO:0008134 F transcription factor binding
GO:0008271 F secondary active sulfate transmembrane transporter activity
GO:0008272 P sulfate transport
GO:0008360 P regulation of cell shape
GO:0009751 P response to salicylic acid
GO:0010996 P response to auditory stimulus
GO:0015106 F bicarbonate transmembrane transporter activity
GO:0015116 F sulfate transmembrane transporter activity
GO:0015301 F anion:anion antiporter activity
GO:0015701 P bicarbonate transport
GO:0015755 P fructose transmembrane transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016323 C basolateral plasma membrane
GO:0016328 C lateral plasma membrane
GO:0019531 F oxalate transmembrane transporter activity
GO:0019532 P oxalate transport
GO:0030507 F spectrin binding
GO:0034220 P ion transmembrane transport
GO:0034766 P negative regulation of ion transmembrane transport
GO:0035864 P response to potassium ion
GO:0042391 P regulation of membrane potential
GO:0042493 P response to xenobiotic stimulus
GO:0042803 F protein homodimerization activity
GO:0045793 P positive regulation of cell size
GO:0051262 P protein tetramerization
GO:0051453 P regulation of intracellular pH
GO:0055085 P transmembrane transport
GO:0090102 P cochlea development
GO:0097066 P response to thyroid hormone
GO:0098656 P anion transmembrane transport
GO:1902074 P response to salt
GO:1902358 P sulfate transmembrane transport
GO:1902476 P chloride transmembrane transport
GO:2000147 P positive regulation of cell motility
RNA-seq EntryA_BomoSK_comp10340_c1_seq1
Sequence
(Amino Acid)
VVSASLILCVLLWIGPFFEDLPRCVLAGIIVVSLKGMFMQMKELTKFWGLSKLDAMVWLI
TFLVTLIVNIDIGLGAGLLASVGALFCRSQKPYTCLLGRVLDTDLYLDTKRYRAAEELPG
IKIFHYCGGLNFASKNLFRSTLFRKIGYMKPAVVTHDEDNNLTKSESYEWDPSISHKVQC
VIIDATALSYVDAPGIKSLIPVQRELVSSNITVLLAGANGPVLEMIERYNNLEAERLQLD
TFPTVHDAVVYYNVSEARKHDVPVTIAP
*(88 a.a.)

- SilkBase 1999-2023 -