SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoSK6885_complete:A_BomoSK_comp10196_c0_seq1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)		hormone_receptor_39_[Danaus_plexippus]
Ontology
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003707 F steroid hormone receptor activity
GO:0003712 F transcription coregulator activity
GO:0004879 F nuclear receptor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008270 F zinc ion binding
GO:0009755 P hormone-mediated signaling pathway
GO:0009888 P tissue development
GO:0010906 P regulation of glucose metabolic process
GO:0016321 P female meiosis chromosome segregation
GO:0030522 P intracellular receptor signaling pathway
GO:0035211 P spermathecum morphogenesis
GO:0043401 P steroid hormone mediated signaling pathway
GO:0043565 F sequence-specific DNA binding
GO:0045433 P male courtship behavior, veined wing generated song production
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0060968 P obsolete regulation of gene silencing
GO:0090575 C RNA polymerase II transcription regulator complex
RNA-seq EntryA_BomoSK_comp10196_c0_seq1
Sequence
(Amino Acid)
MLSFTDHLRRLRVDRYEYVALKVIVLLTSDAPELRESEKVRASQEKALAALQAYIATHSP
GTPAKFGELLLRIPELQRTCQFFMQVGKEMLNPANKNKDGDGQSFNLLMELLRGDH
*(38 a.a.)

- SilkBase 1999-2023 -