SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoSK6699_3prime_partial:A_BomoSK_comp10057_c0_seq1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)		PREDICTED:_phosphatase_and_actin_regulator_4B_[Papilio_polytes]
Ontology
GO:0001755 P neural crest cell migration
GO:0001843 P neural tube closure
GO:0003779 F actin binding
GO:0005622 C intracellular anatomical structure
GO:0005737 C cytoplasm
GO:0007266 P Rho protein signal transduction
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0008157 F protein phosphatase 1 binding
GO:0008599 F protein phosphatase regulator activity
GO:0030027 C lamellipodium
GO:0030036 P actin cytoskeleton organization
GO:0042995 C cell projection
GO:0043085 P positive regulation of catalytic activity
GO:0048484 P enteric nervous system development
GO:0051726 P regulation of cell cycle
GO:0061386 P closure of optic fissure
GO:0071862 F protein phosphatase activator activity
GO:2001045 P negative regulation of integrin-mediated signaling pathway
RNA-seq EntryA_BomoSK_comp10057_c0_seq1
Sequence
(Amino Acid)
MRPTAEELVERNILKSQSPAEEKKQKEEKKRYLLRKLSFRPTVDELKEKKIIRFSDYIEV
TQAHDYDRRADKPWTRLTPRDKAAIRRELNEFKSSEMAVHEDSKHLTRYELHLSLSR
(38 a.a.)

- SilkBase 1999-2023 -