SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoSK6646_5prime_partial:A_BomoSK_comp10002_c0_seq2
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)		PREDICTED:_rab11_family-interacting_protein_4_isoform_X3_[Bombyx_mori]
Ontology
GO:0000910 P cytokinesis
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0006810 P transport
GO:0007049 P cell cycle
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0017137 F small GTPase binding
GO:0030306 F small GTPase binding
GO:0030496 C midbody
GO:0032154 C cleavage furrow
GO:0032456 P endocytic recycling
GO:0042803 F protein homodimerization activity
GO:0043231 C intracellular membrane-bounded organelle
GO:0045171 C intercellular bridge
GO:0046872 F metal ion binding
GO:0051301 P cell division
GO:0051959 F dynein light intermediate chain binding
GO:0055037 C recycling endosome
GO:0055038 C recycling endosome membrane
GO:0061512 P protein localization to cilium
GO:0070164 P negative regulation of adiponectin secretion
RNA-seq EntryA_BomoSK_comp10002_c0_seq2
Sequence
(Amino Acid)
LALRDAPPPPPDPRLDELTKELVLLRTQNKSLSEAQEELQAQILTRGVEEGRSLLDGVSG
PLVATNSLAHELSQMSDDQLEGSQTQTEHDIELEKVRYF
*(32 a.a.)

- SilkBase 1999-2023 -