SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK16762_complete:A_BomoSK_comp13924_c0_seq9
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0000287 F magnesium ion binding
GO:0004357 F glutamate-cysteine ligase activity
GO:0005524 F ATP binding
GO:0005829 C cytosol
GO:0006534 P cysteine metabolic process
GO:0006536 P glutamate metabolic process
GO:0006749 P glutathione metabolic process
GO:0006750 P glutathione biosynthetic process
GO:0006979 P response to oxidative stress
GO:0008637 P apoptotic mitochondrial changes
GO:0009408 P response to heat
GO:0009410 P response to xenobiotic stimulus
GO:0009725 P response to hormone
GO:0016595 F glutamate binding
GO:0016874 F ligase activity
GO:0017109 C glutamate-cysteine ligase complex
GO:0019852 P L-ascorbic acid metabolic process
GO:0031397 P negative regulation of protein ubiquitination
GO:0032436 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0043066 P negative regulation of apoptotic process
GO:0043524 P negative regulation of neuron apoptotic process
GO:0043531 F ADP binding
GO:0045454 P cell redox homeostasis
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046685 P response to arsenic-containing substance
GO:0046982 F protein heterodimerization activity
GO:0050662 F obsolete coenzyme binding
GO:0050880 P blood vessel diameter maintenance
GO:0051409 P response to nitrosative stress
GO:0051900 P regulation of mitochondrial depolarization
GO:2001237 P negative regulation of extrinsic apoptotic signaling pathway
RNA-seq EntryA_BomoSK_comp13924_c0_seq9
Sequence
(Amino Acid)
MRFKPPPPNSSIGWRVEFRPCEAQLTDFENAAYVCFVVLLTRVILSYQLNFVMPISKVDE
NMQRAQRRGACLNEKFWWRRDVGAPRDVAPPHSDATDEYHEMSINDIVNGKEGVFPGLIP
LIESYLSGMDVDADTHCSVQQYLKLIQRRAAGDIVTTASWLRAFVTNHPHYKKDSVVTEK
INYDLLKTAHGIQDGSIPAPTLLGGGNVSKTNEDIPKAFTKMMSRDCS
*(75 a.a.)

- SilkBase 1999-2023 -