SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoSK16633_5prime_partial:A_BomoSK_comp13901_c0_seq1
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001954 P positive regulation of cell-matrix adhesion
GO:0002221 P pattern recognition receptor signaling pathway
GO:0005041 F low-density lipoprotein particle receptor activity
GO:0005515 F protein binding
GO:0005615 C extracellular space
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006898 P receptor-mediated endocytosis
GO:0006910 P phagocytosis, recognition
GO:0006955 P immune response
GO:0007155 P cell adhesion
GO:0007166 P cell surface receptor signaling pathway
GO:0007204 P positive regulation of cytosolic calcium ion concentration
GO:0007263 P nitric oxide mediated signal transduction
GO:0008035 F high-density lipoprotein particle binding
GO:0008289 F lipid binding
GO:0009897 C external side of plasma membrane
GO:0009986 C cell surface
GO:0010629 P negative regulation of gene expression
GO:0010744 P positive regulation of macrophage derived foam cell differentiation
GO:0010886 P positive regulation of cholesterol storage
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0019915 P lipid storage
GO:0019934 P cGMP-mediated signaling
GO:0030169 F low-density lipoprotein particle binding
GO:0030194 P positive regulation of blood coagulation
GO:0030299 P intestinal cholesterol absorption
GO:0030301 P cholesterol transport
GO:0031526 C brush border membrane
GO:0031623 P receptor internalization
GO:0032735 P positive regulation of interleukin-12 production
GO:0032755 P positive regulation of interleukin-6 production
GO:0032760 P positive regulation of tumor necrosis factor production
GO:0033993 P response to lipid
GO:0034197 P triglyceride transport
GO:0034381 P plasma lipoprotein particle clearance
GO:0034383 P low-density lipoprotein particle clearance
GO:0035634 P response to stilbenoid
GO:0042953 P lipoprotein transport
GO:0042992 P obsolete negative regulation of transcription factor import into nucleus
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043277 P apoptotic cell clearance
GO:0043410 P positive regulation of MAPK cascade
GO:0043619 P regulation of transcription from RNA polymerase II promoter in response to oxidative stress
GO:0044130 P obsolete negative regulation of growth of symbiont in host
GO:0044539 P long-chain fatty acid import into cell
GO:0045121 C membrane raft
GO:0045177 C apical part of cell
GO:0050702 P interleukin-1 beta production
GO:0050731 P positive regulation of peptidyl-tyrosine phosphorylation
GO:0050830 P defense response to Gram-positive bacterium
GO:0050892 P intestinal absorption
GO:0050909 P sensory perception of taste
GO:0055096 P low-density lipoprotein particle mediated signaling
GO:0060100 P positive regulation of phagocytosis, engulfment
GO:0060907 P positive regulation of macrophage cytokine production
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:0070508 P cholesterol import
GO:0070542 P response to fatty acid
GO:0070543 P response to linoleic acid
GO:0070892 F lipoteichoic acid immune receptor activity
GO:0071221 P cellular response to bacterial lipopeptide
GO:0071222 P cellular response to lipopolysaccharide
GO:0071223 P cellular response to lipoteichoic acid
GO:0071404 P cellular response to low-density lipoprotein particle stimulus
GO:0071447 P cellular response to hydroperoxide
GO:0071726 P cellular response to diacyl bacterial lipopeptide
GO:0071813 F lipoprotein particle binding
GO:1900227 P positive regulation of NLRP3 inflammasome complex assembly
GO:1990000 P amyloid fibril formation
GO:2000121 P regulation of removal of superoxide radicals
GO:2000334 P positive regulation of blood microparticle formation
GO:2000379 P positive regulation of reactive oxygen species metabolic process
GO:2000505 P energy homeostasis
RNA-seq EntryA_BomoSK_comp13901_c0_seq1
Sequence
(Amino Acid)
TGEKNIDRMNIIEKFDGRDHLTYWGSPECNSLEATDGSIFPPSQLDKNKTLYVFYPQLCR
RLPFRFEKEVETYGVKLLRYKMPVNVFDDAKHNPANQCYCEIDTATCPPKGVINVTDCTM
GAPALVSFPHFNLGDPFLLDRISGLHPDPLKHISYLDIHPTLGIALKGKSSLQLNIQVRK
TNYFSNLHFLDQGLILPIAWIEMGVDELPESLQALVYHGTFSTAAAQLGLSVICILTLII
SSLCLCLTIVGRRKKPCVTLKKTPAEITKNQDSS
*(90 a.a.)

- SilkBase 1999-2023 -