SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK16480_complete:A_BomoSK_comp13867_c0_seq3
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0003682 F chromatin binding
GO:0004407 F histone deacetylase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005720 C heterochromatin
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005814 C centriole
GO:0005815 C microtubule organizing center
GO:0005819 C spindle
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0005886 C plasma membrane
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006476 P protein deacetylation
GO:0006914 P autophagy
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007399 P nervous system development
GO:0007417 P central nervous system development
GO:0008134 F transcription factor binding
GO:0008270 F zinc ion binding
GO:0008285 P negative regulation of cell population proliferation
GO:0010507 P negative regulation of autophagy
GO:0010801 P negative regulation of peptidyl-threonine phosphorylation
GO:0014065 P phosphatidylinositol 3-kinase signaling
GO:0016020 C membrane
GO:0016575 P histone deacetylation
GO:0016787 F hydrolase activity
GO:0016811 F hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0017136 F NAD-dependent histone deacetylase activity
GO:0021762 P substantia nigra development
GO:0022011 P myelination in peripheral nervous system
GO:0030154 P cell differentiation
GO:0030426 C growth cone
GO:0030496 C midbody
GO:0031641 P regulation of myelination
GO:0032436 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0033010 C paranodal junction
GO:0033270 C paranode region of axon
GO:0033558 F protein deacetylase activity
GO:0034599 P cellular response to oxidative stress
GO:0034979 F NAD-dependent protein deacetylase activity
GO:0034983 P peptidyl-lysine deacetylation
GO:0035035 F histone acetyltransferase binding
GO:0035729 P cellular response to hepatocyte growth factor stimulus
GO:0035748 C myelin sheath abaxonal region
GO:0042177 P negative regulation of protein catabolic process
GO:0042826 F histone deacetylase binding
GO:0042903 F tubulin deacetylase activity
GO:0042995 C cell projection
GO:0043066 P negative regulation of apoptotic process
GO:0043130 F ubiquitin binding
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043204 C perikaryon
GO:0043209 C myelin sheath
GO:0043219 C lateral loop
GO:0043220 C Schmidt-Lanterman incisure
GO:0043388 P positive regulation of DNA binding
GO:0043491 P protein kinase B signaling
GO:0044224 C juxtaparanode region of axon
GO:0044242 P cellular lipid catabolic process
GO:0045598 P regulation of fat cell differentiation
GO:0045599 P negative regulation of fat cell differentiation
GO:0045836 P positive regulation of meiotic nuclear division
GO:0045843 P negative regulation of striated muscle tissue development
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0046970 F NAD-dependent histone deacetylase activity (H4-K16 specific)
GO:0048012 P hepatocyte growth factor receptor signaling pathway
GO:0048471 C perinuclear region of cytoplasm
GO:0048487 F beta-tubulin binding
GO:0048715 P negative regulation of oligodendrocyte differentiation
GO:0051287 F NAD binding
GO:0051301 P cell division
GO:0051321 P meiotic cell cycle
GO:0051726 P regulation of cell cycle
GO:0051781 P positive regulation of cell division
GO:0051987 P positive regulation of attachment of spindle microtubules to kinetochore
GO:0061428 P negative regulation of transcription from RNA polymerase II promoter in response to hypoxia
GO:0061433 P cellular response to caloric restriction
GO:0070403 F NAD+ binding
GO:0070446 P negative regulation of oligodendrocyte progenitor proliferation
GO:0070932 P histone H3 deacetylation
GO:0070933 P histone H4 deacetylation
GO:0071219 P cellular response to molecule of bacterial origin
GO:0071456 P cellular response to hypoxia
GO:0071872 P cellular response to epinephrine stimulus
GO:0072686 C mitotic spindle
GO:0072687 C meiotic spindle
GO:0090042 P tubulin deacetylation
GO:0097386 C glial cell projection
GO:0097456 C terminal loop
GO:1900119 P positive regulation of execution phase of apoptosis
GO:1900195 P positive regulation of oocyte maturation
GO:1900226 P negative regulation of NLRP3 inflammasome complex assembly
GO:1900425 P negative regulation of defense response to bacterium
GO:1901026 P ripoptosome assembly involved in necroptotic process
GO:2000378 P negative regulation of reactive oxygen species metabolic process
GO:2000777 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process involved in cellular response to hypoxia
RNA-seq EntryA_BomoSK_comp13867_c0_seq3
Sequence
(Amino Acid)
MKIIFYNITFYSPGLLLRHYTQNIDTLERGAGIPEEKLVEAHGTFYTSHCLDCRKEYPLE
FVKERIFADQIPICTECPGVVKPDIVFFGESLPERFQMCLEEDFKQCDMLIIMGSSLEVQ
PFASLIDMVPDSCPRLLINREKAGVRPPILRIRGLMCGGLQLDEGSYRDVARLGDCDEGC
QDLADRLGWGDELRALVAREHERLDQELLTASPHAPVLIPSEANAGPSASE
*(76 a.a.)

- SilkBase 1999-2023 -