SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoSK163_internal:A_BomoSK_comp538_c0_seq1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)		PREDICTED:_LOW_QUALITY_PROTEIN:_partitioning_defective_3_homolog_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0005546 F phosphatidylinositol-4,5-bisphosphate binding
GO:0005547 F phosphatidylinositol-3,4,5-trisphosphate binding
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0005923 C bicellular tight junction
GO:0005938 C cell cortex
GO:0006612 P protein targeting to membrane
GO:0007049 P cell cycle
GO:0008289 F lipid binding
GO:0010801 P negative regulation of peptidyl-threonine phosphorylation
GO:0012505 C endomembrane system
GO:0016020 C membrane
GO:0019903 F protein phosphatase binding
GO:0022011 P myelination in peripheral nervous system
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0031643 P positive regulation of myelination
GO:0032266 F phosphatidylinositol-3-phosphate binding
GO:0033269 C internode region of axon
GO:0043025 C neuronal cell body
GO:0043234 C protein-containing complex
GO:0044295 C axonal growth cone
GO:0045197 P establishment or maintenance of epithelial cell apical/basal polarity
GO:0051301 P cell division
GO:0060341 P regulation of cellular localization
GO:0070830 P bicellular tight junction assembly
GO:0090162 P establishment of epithelial cell polarity
RNA-seq EntryA_BomoSK_comp538_c0_seq1
Sequence
(Amino Acid)
EPGPETWIGVRALRANSGGILDPDDRVCDVADDRETLTAECTSQTPQPRAAQADGASGSS
AGTASPDMFRGGGGVGGSIRVPHPDSCVEVGEADLEDGVNGLQVRRGSEPSLHQDTLPPQ
RQVSEQTKRWSAAVVGRDDCTRITQKVHPMSDGRQ
(50 a.a.)

- SilkBase 1999-2023 -