SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoSK15736_complete:A_BomoSK_comp13731_c0_seq3
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)
Ontology
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006897 P endocytosis
GO:0006997 P nucleus organization
GO:0007275 P multicellular organism development
GO:0008283 P cell population proliferation
GO:0015629 C actin cytoskeleton
GO:0016020 C membrane
GO:0016032 P viral process
GO:0030018 C Z disc
GO:0030100 P regulation of endocytosis
GO:0030154 P cell differentiation
GO:0030315 C T-tubule
GO:0030424 C axon
GO:0031674 C I band
GO:0033268 C node of Ranvier
GO:0042692 P muscle cell differentiation
GO:0042802 F identical protein binding
GO:0043065 P positive regulation of apoptotic process
GO:0043194 C axon initial segment
GO:0045664 P regulation of neuron differentiation
GO:0048156 F tau protein binding
GO:0048711 P positive regulation of astrocyte differentiation
GO:0051015 F actin filament binding
GO:0060987 C lipid tube
GO:0060988 P lipid tube assembly
GO:0070063 F RNA polymerase binding
GO:0071156 P regulation of cell cycle
RNA-seq EntryA_BomoSK_comp13731_c0_seq3
Sequence
(Amino Acid)
MNNNEETNKHTNVEQNLIEKNEKRNSENAEEVYDIPVGATLAGLPPGVLYRVRATYRYTR
EDSDELSFEVGDIIRVVEYDDPDEQEEGWLMGIKETTNEKGMFPANFTRPI
*(36 a.a.)

- SilkBase 1999-2023 -