SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK15125_complete:A_BomoSK_comp13645_c1_seq2
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)
PREDICTED:_uncharacterized_protein_LOC101738134_isoform_X3_[Bombyx_mori]
Ontology
GO:0001822 P kidney development
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006810 P transport
GO:0006915 P apoptotic process
GO:0007130 P synaptonemal complex assembly
GO:0007283 P spermatogenesis
GO:0007420 P brain development
GO:0009790 P embryo development
GO:0016568 P chromatin organization
GO:0018393 P internal peptidyl-lysine acetylation
GO:0030324 P lung development
GO:0031593 F polyubiquitin modification-dependent protein binding
GO:0032435 P negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0042771 P intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0042981 P regulation of apoptotic process
GO:0043022 F ribosome binding
GO:0045861 P negative regulation of proteolysis
GO:0050821 P protein stabilization
GO:0070059 P intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0070628 F proteasome binding
GO:0071816 P tail-anchored membrane protein insertion into ER membrane
GO:0071818 C BAT3 complex
RNA-seq EntryA_BomoSK_comp13645_c1_seq2
Sequence
(Amino Acid)
MIEFTIKTLDAVNHEMSVDDEITVQQLKEKVREQMGIEIHLQRLIFCGRVLQDDKKLTEY
DVHGKVVHLVQRAPPSPQSRQSTINPLGPASAHIHTSEGQNNGLHHQIRHLLALTPDFLI
EQQQQMNLSPTAGRMEFIRRLIADIKTSLAQLNAHITGTVI
*(53 a.a.)

- SilkBase 1999-2023 -