SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK15037_complete:A_BomoSK_comp13633_c0_seq2
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
PREDICTED:_DNA_repair_protein_complementing_XP-G_cells_[Papilio_polytes]
Ontology
GO:0000405 F bubble DNA binding
GO:0003677 F DNA binding
GO:0003690 F double-stranded DNA binding
GO:0003697 F single-stranded DNA binding
GO:0003824 F catalytic activity
GO:0004518 F nuclease activity
GO:0004519 F endonuclease activity
GO:0004520 F endodeoxyribonuclease activity
GO:0005634 C nucleus
GO:0005662 C DNA replication factor A complex
GO:0005675 C transcription factor TFIIH holo complex
GO:0006281 P DNA repair
GO:0006283 P transcription-coupled nucleotide-excision repair
GO:0006289 P nucleotide-excision repair
GO:0006295 P nucleotide-excision repair, DNA incision, 3'-to lesion
GO:0006974 P cellular response to DNA damage stimulus
GO:0008340 P determination of adult lifespan
GO:0009411 P response to UV
GO:0009650 P UV protection
GO:0010225 P response to UV-C
GO:0016591 C RNA polymerase II, holoenzyme
GO:0016787 F hydrolase activity
GO:0016788 F hydrolase activity, acting on ester bonds
GO:0035264 P multicellular organism growth
GO:0042803 F protein homodimerization activity
GO:0043066 P negative regulation of apoptotic process
GO:0046872 F metal ion binding
GO:0047485 F protein N-terminus binding
RNA-seq EntryA_BomoSK_comp13633_c0_seq2
Sequence
(Amino Acid)
MGVTGLWRLIEPTGKPVPVETLENKVLAVDISIWLHQMVKGYQDAKGAPLANAHLMGLFQ
RLCKLLYFRIKPIFVFDGGFPDLKKETISKRQDHKAKYNSESERIKRELALLLSKKTAIN
SLLGKQISPKKNVAQTENEDNIFKLPELPKKNQESESDVFRFQF
*(54 a.a.)

- SilkBase 1999-2023 -