SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK14545_internal:A_BomoSK_comp13559_c0_seq1
Scaffold_idBomo_Chr20
NCBI non-redundant
(nr)
PREDICTED:_actin-binding_protein_anillin-like_isoform_X3_[Papilio_machaon]
Ontology
GO:0000281 P mitotic cytokinesis
GO:0000910 P cytokinesis
GO:0000915 P actomyosin contractile ring assembly
GO:0003779 F actin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005826 C actomyosin contractile ring
GO:0005856 C cytoskeleton
GO:0005938 C cell cortex
GO:0007009 P plasma membrane organization
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007112 P male meiosis cytokinesis
GO:0007275 P multicellular organism development
GO:0007279 P pole cell formation
GO:0007283 P spermatogenesis
GO:0007349 P cellularization
GO:0007423 P sensory organ development
GO:0008017 F microtubule binding
GO:0008104 P protein localization
GO:0008356 P asymmetric cell division
GO:0017022 F myosin binding
GO:0022008 P neurogenesis
GO:0030154 P cell differentiation
GO:0030726 P male germline ring canal formation
GO:0031106 P septin ring organization
GO:0032154 C cleavage furrow
GO:0032189 P maintenance of actomyosin contractile ring localization
GO:0032465 P regulation of cytokinesis
GO:0035323 C male germline ring canal
GO:0043063 P intercellular bridge organization
GO:0045035 P sensory organ precursor cell division
GO:0045172 C germline ring canal
GO:0048477 P oogenesis
GO:0051015 F actin filament binding
GO:0051297 P centrosome cycle
GO:0051301 P cell division
GO:0051321 P meiotic cell cycle
GO:0051533 P positive regulation of calcineurin-NFAT signaling cascade
GO:0070938 C contractile ring
RNA-seq EntryA_BomoSK_comp13559_c0_seq1
Sequence
(Amino Acid)
ARPGPPAPRHDKGSELVHSVSFYRRMQNSSSTPSTPLRVIRHASPERGVPPSSPEEPAAA
VTVRQRIKELQNEITKQQTVISQASQALNLCAATIEFSGSTEQAEGERLLLLATHRRQ
(38 a.a.)

- SilkBase 1999-2023 -