SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK1445_3prime_partial:A_BomoSK_comp4230_c0_seq1
Scaffold_idBomo_Chr28
NCBI non-redundant
(nr)
PREDICTED:_insulin_gene_enhancer_protein_ISL-1_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001102 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001105 F transcription coactivator activity
GO:0001158 F cis-regulatory region sequence-specific DNA binding
GO:0001755 P neural crest cell migration
GO:0003007 P heart morphogenesis
GO:0003139 P secondary heart field specification
GO:0003148 P outflow tract septum morphogenesis
GO:0003151 P outflow tract morphogenesis
GO:0003203 P endocardial cushion morphogenesis
GO:0003215 P cardiac right ventricle morphogenesis
GO:0003266 P regulation of secondary heart field cardioblast proliferation
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007507 P heart development
GO:0008270 F zinc ion binding
GO:0008284 P positive regulation of cell population proliferation
GO:0010468 P regulation of gene expression
GO:0010575 P positive regulation of vascular endothelial growth factor production
GO:0016922 F nuclear receptor binding
GO:0021520 P spinal cord motor neuron cell fate specification
GO:0021522 P spinal cord motor neuron differentiation
GO:0021524 P visceral motor neuron differentiation
GO:0021559 P trigeminal nerve development
GO:0021983 P pituitary gland development
GO:0030182 P neuron differentiation
GO:0030331 F estrogen receptor binding
GO:0031016 P pancreas development
GO:0031103 P axon regeneration
GO:0031290 P retinal ganglion cell axon guidance
GO:0032024 P positive regulation of insulin secretion
GO:0032725 P positive regulation of granulocyte macrophage colony-stimulating factor production
GO:0032729 P positive regulation of interferon-gamma production
GO:0032730 P positive regulation of interleukin-1 alpha production
GO:0032731 P positive regulation of interleukin-1 beta production
GO:0032735 P positive regulation of interleukin-12 production
GO:0032755 P positive regulation of interleukin-6 production
GO:0032760 P positive regulation of tumor necrosis factor production
GO:0033147 P negative regulation of intracellular estrogen receptor signaling pathway
GO:0035066 P positive regulation of histone acetylation
GO:0042517 P positive regulation of tyrosine phosphorylation of STAT protein
GO:0043388 P positive regulation of DNA binding
GO:0043425 F bHLH transcription factor binding
GO:0043524 P negative regulation of neuron apoptotic process
GO:0043565 F sequence-specific DNA binding
GO:0045665 P negative regulation of neuron differentiation
GO:0045766 P positive regulation of angiogenesis
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0048663 P neuron fate commitment
GO:0048665 P neuron fate specification
GO:0048762 P mesenchymal cell differentiation
GO:0048880 P sensory system development
GO:0048935 P peripheral nervous system neuron development
GO:0048936 P peripheral nervous system neuron axonogenesis
GO:0050728 P negative regulation of inflammatory response
GO:0055010 P ventricular cardiac muscle tissue morphogenesis
GO:0060037 P pharyngeal system development
GO:0060379 P cardiac muscle cell myoblast differentiation
GO:0060384 P innervation
GO:0060413 P atrial septum morphogenesis
GO:0060913 P cardiac cell fate determination
GO:0071385 P cellular response to glucocorticoid stimulus
GO:0071657 P positive regulation of granulocyte colony-stimulating factor production
GO:0090074 P negative regulation of protein homodimerization activity
GO:0090090 P negative regulation of canonical Wnt signaling pathway
GO:1901258 P positive regulation of macrophage colony-stimulating factor production
RNA-seq EntryA_BomoSK_comp4230_c0_seq1
Sequence
(Amino Acid)
MVMASGGGGGLIQSPPDMMHHHNIMDTSSHVEMMPKKLRLSLCVGCGGQIHDQYILRVAP
DLEWHAACLKCQECRQFLDESCTCFVRDGKTYCKRDYTRLFGTKCDKCGASFSKNDFVMR
AKTKIYHIDCFRCCACARQLIPGDEFALREGGALYCREDHDVLEKSANTSGGSSNNAESN
NNTTLSNNNSHHPHELGSMSDSGSESGSHKSGRARTTAAADGKPTRVRTVLNEKQLHTLR
TCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKTLQLKMQMQQEKEGRRLG
YMSVGVPLVAGAPV
(103 a.a.)

- SilkBase 1999-2023 -