SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK14321_internal:A_BomoSK_comp13501_c0_seq2
Scaffold_idBomo_Chr14
NCBI non-redundant
(nr)
PREDICTED:_venom_acid_phosphatase_Acph-1-like_[Papilio_polytes]
Ontology
GO:0003993 F acid phosphatase activity
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005771 C multivesicular body
GO:0005886 C plasma membrane
GO:0006144 P purine nucleobase metabolic process
GO:0006772 P thiamine metabolic process
GO:0008253 F 5'-nucleotidase activity
GO:0009117 P nucleotide metabolic process
GO:0012506 C vesicle membrane
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016311 P dephosphorylation
GO:0016787 F hydrolase activity
GO:0016791 F phosphatase activity
GO:0030141 C secretory granule
GO:0030175 C filopodium
GO:0031985 C Golgi cisterna
GO:0033265 F choline binding
GO:0042131 F thiamine phosphate phosphatase activity
GO:0042802 F identical protein binding
GO:0045177 C apical part of cell
GO:0046085 P adenosine metabolic process
GO:0051930 P regulation of sensory perception of pain
GO:0052642 F lysophosphatidic acid phosphatase activity
GO:0060168 P positive regulation of adenosine receptor signaling pathway
GO:0070062 C extracellular exosome
RNA-seq EntryA_BomoSK_comp13501_c0_seq2
Sequence
(Amino Acid)
RHQDRSVLKRRLGATRTSPVQTNHYLYNYSSDKMLKYLIFVYLLMQVNTSPGNVTNREAN
DDMELLMVYFVNRHGERAPDDVELSLSDQQEELKSLTHVEGPEGLTNVGKRRAYQIGKFI
RQRYGSEGSKILSKVYLKDEILVRSTDKDRTKMTALVAMSAAYPPEPVQQW
(56 a.a.)

- SilkBase 1999-2023 -