SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoSK14256_complete:A_BomoSK_comp13489_c0_seq2
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)		PREDICTED:_tyrosine-protein_kinase_shark_[Papilio_xuthus]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004715 F non-membrane spanning protein tyrosine kinase activity
GO:0005102 F signaling receptor binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005938 C cell cortex
GO:0006468 P protein phosphorylation
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007254 P JNK cascade
GO:0007306 P eggshell chorion assembly
GO:0007391 P dorsal closure
GO:0007394 P dorsal closure, elongation of leading edge cells
GO:0010906 P regulation of glucose metabolic process
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016477 P cell migration
GO:0016740 F transferase activity
GO:0031234 C extrinsic component of cytoplasmic side of plasma membrane
GO:0038083 P peptidyl-tyrosine autophosphorylation
GO:0042127 P regulation of cell population proliferation
GO:0043277 P apoptotic cell clearance
GO:0045087 P innate immune response
GO:0045199 P maintenance of epithelial cell apical/basal polarity
GO:0046843 P dorsal appendage formation
GO:0048812 P neuron projection morphogenesis
RNA-seq EntryA_BomoSK_comp13489_c0_seq2
Sequence
(Amino Acid)
MITTMTSFILLKTNSFLLRMNREDNVNWFHGKISRESAEKLLKEEGEDGVFLVRESNTSP
GDYVLSVLHQGQVVHYQIRRHGEDAFFSIEEHTTVHGLDTLIQHYRSDSNGLVTRLSIVC
KGEPPPHESRTQGTTNLLHRATEAGHFNVVSKLLASGYRSRDAKNQDGQTAVHIAARAGR
DTILAELIESGSTVNVRDSFGYTPLHVCSISLIQTST
*(71 a.a.)

- SilkBase 1999-2023 -