SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK14135_internal:A_BomoSK_comp13470_c0_seq4
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)
PREDICTED:_vascular_endothelial_growth_factor_receptor_1_isoform_X2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000186 P obsolete activation of MAPKK activity
GO:0001525 P angiogenesis
GO:0001666 P response to hypoxia
GO:0002548 P monocyte chemotaxis
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004714 F transmembrane receptor protein tyrosine kinase activity
GO:0005021 F vascular endothelial growth factor-activated receptor activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005925 C focal adhesion
GO:0006468 P protein phosphorylation
GO:0006935 P chemotaxis
GO:0006940 P regulation of smooth muscle contraction
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007275 P multicellular organism development
GO:0008284 P positive regulation of cell population proliferation
GO:0010863 P positive regulation of phospholipase C activity
GO:0014068 P positive regulation of phosphatidylinositol 3-kinase signaling
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016477 P cell migration
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0019838 F growth factor binding
GO:0030154 P cell differentiation
GO:0030335 P positive regulation of cell migration
GO:0030522 P intracellular receptor signaling pathway
GO:0030949 P positive regulation of vascular endothelial growth factor receptor signaling pathway
GO:0035924 P cellular response to vascular endothelial growth factor stimulus
GO:0036323 P vascular endothelial growth factor receptor-1 signaling pathway
GO:0036326 F vascular endothelial growth factor-activated receptor activity
GO:0036327 F vascular endothelial growth factor-activated receptor activity
GO:0036332 F placental growth factor-activated receptor activity
GO:0038084 P vascular endothelial growth factor signaling pathway
GO:0043235 C receptor complex
GO:0043406 P positive regulation of MAP kinase activity
GO:0043410 P positive regulation of MAPK cascade
GO:0043552 P positive regulation of phosphatidylinositol 3-kinase activity
GO:0045766 P positive regulation of angiogenesis
GO:0046777 P protein autophosphorylation
GO:0048010 P vascular endothelial growth factor receptor signaling pathway
GO:0048514 P blood vessel morphogenesis
GO:0048598 P embryonic morphogenesis
GO:0048661 P positive regulation of smooth muscle cell proliferation
RNA-seq EntryA_BomoSK_comp13470_c0_seq4
Sequence
(Amino Acid)
VCSSDLLNNASELRRAYTLVLKAEKSYTPYVIVTAVIILVLLGMVAYLFTWKLKKQRELT
KAGLLNFKSGNKKSFNPNLGIDEQADLLPYDEKFEFPREKLTFGKQLGAGAFGVVYKAEA
RGIINAEVTTPVAVKMVKRTADNMYIKALASELKIMVHLGKHVNIVNLLGACTKHIAKRE
LIVIVEYCKYGNIHNYMQKHREVFIDQLTDNAEKNLGKINKGFLNSVGTTGTHSDYFSSG
NTKDTDHSLLYSGNSKRSGRKVSEGYIQQEWQTKYEGDYIYECHQPRPLTSGHLLGWAFQ
IARGMEYLANRKVLHGDLAARNVLLADDNVVKICDFGLARSMYNNEEYQKKENSPLPVKW
LAIECMVDRIFSTQSDVWS
(125 a.a.)

- SilkBase 1999-2023 -