SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoSK13949_complete:A_BomoSK_comp13408_c0_seq4
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)		PREDICTED:_protein_arginine_N-methyltransferase_6_[Bombyx_mori]
Ontology
GO:0003713 F transcription coactivator activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006479 P protein methylation
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007552 P metamorphosis
GO:0008168 F methyltransferase activity
GO:0008170 F N-methyltransferase activity
GO:0008469 F histone-arginine N-methyltransferase activity
GO:0016274 F protein-arginine N-methyltransferase activity
GO:0016571 P histone methylation
GO:0016740 F transferase activity
GO:0018216 P peptidyl-arginine methylation
GO:0019919 P peptidyl-arginine methylation, to asymmetrical-dimethyl arginine
GO:0022008 P neurogenesis
GO:0030154 P cell differentiation
GO:0031056 P regulation of histone modification
GO:0032259 P methylation
GO:0035242 F protein-arginine omega-N asymmetric methyltransferase activity
GO:0035246 P peptidyl-arginine N-methylation
GO:0042054 F histone methyltransferase activity
GO:0043985 P histone H4-R3 methylation
GO:0044020 F histone methyltransferase activity (H4-R3 specific)
GO:0045653 P negative regulation of megakaryocyte differentiation
GO:0045893 P positive regulation of transcription, DNA-templated
RNA-seq EntryA_BomoSK_comp13408_c0_seq4
Sequence
(Amino Acid)
MNSASSMLLELKNLVLMKACVYGSNAIFPVCLKRKTRIVILDTSPNSLATHWKQTAIVLP
QEVEVEEGEPIAFQLSMKRDTEHNRRYNLQMTLLDPEAVDHPQPCSCHMTKCILIKAFME
SH
*(40 a.a.)

- SilkBase 1999-2023 -