SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoSK13872_complete:A_BomoSK_comp13390_c0_seq4
Scaffold_idBomo_Scaf361
NCBI non-redundant
(nr)		PREDICTED:_gamma-tubulin_complex_component_2-like_isoform_X2_[Bombyx_mori]
Ontology
GO:0000226 P microtubule cytoskeleton organization
GO:0000922 C spindle pole
GO:0000923 C equatorial microtubule organizing center
GO:0005200 F structural constituent of cytoskeleton
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005816 C spindle pole body
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0005875 C microtubule associated complex
GO:0007017 P microtubule-based process
GO:0007020 P microtubule nucleation
GO:0007052 P mitotic spindle organization
GO:0007067 P mitotic cell cycle
GO:0007126 P meiotic cell cycle
GO:0007283 P spermatogenesis
GO:0008017 F microtubule binding
GO:0008275 C gamma-tubulin small complex
GO:0030953 P astral microtubule organization
GO:0043015 F gamma-tubulin binding
GO:0051011 F microtubule minus-end binding
GO:0051225 P spindle assembly
GO:0051297 P centrosome cycle
GO:0051298 P centrosome duplication
GO:0051415 P microtubule nucleation by interphase microtubule organizing center
GO:0051726 P regulation of cell cycle
GO:0072686 C mitotic spindle
GO:0090063 P positive regulation of microtubule nucleation
GO:0090307 P mitotic spindle assembly
RNA-seq EntryA_BomoSK_comp13390_c0_seq4
Sequence
(Amino Acid)
MLTNPQLLKAVTTLCLVCVQFCSFIQEAGCGTTTSSSADSFSRSVSRYGLRFTAALLSVL
AIIDRNARDNNTNKLLNISARLNFNTYYAKQLEKFCSDDKLLDCEKKTPSS
*(36 a.a.)

- SilkBase 1999-2023 -