SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK13771_complete:A_BomoSK_comp13358_c0_seq2
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
PREDICTED:_putative_leucine-rich_repeat-containing_protein_DDB_G0290503_[Bombyx_mori]
Ontology
GO:0000137 C Golgi cis cisterna
GO:0000139 C Golgi membrane
GO:0000922 C spindle pole
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005801 C cis-Golgi network
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0006486 P protein glycosylation
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0007020 P microtubule nucleation
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007092 P positive regulation of ubiquitin protein ligase activity
GO:0008017 F microtubule binding
GO:0008356 P asymmetric cell division
GO:0010507 P negative regulation of autophagy
GO:0016020 C membrane
GO:0019901 F protein kinase binding
GO:0019905 F syntaxin binding
GO:0030134 C COPII-coated ER to Golgi transport vesicle
GO:0032091 P negative regulation of protein binding
GO:0032580 C Golgi cisterna membrane
GO:0033116 C endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0048208 P COPII vesicle coating
GO:0051225 P spindle assembly
GO:0051289 P protein homotetramerization
GO:0051297 P centrosome cycle
GO:0051301 P cell division
GO:0060050 P positive regulation of protein glycosylation
GO:0061676 F importin-alpha family protein binding
GO:0072686 C mitotic spindle
GO:0090161 P Golgi ribbon formation
GO:0090166 P Golgi disassembly
GO:0090306 P meiotic spindle assembly
GO:0090307 P mitotic spindle assembly
RNA-seq EntryA_BomoSK_comp13358_c0_seq2
Sequence
(Amino Acid)
MLIKLKAKDSEMIRLQSSYREMEINLRNAAKSNESANDDISNEISECEKPLDSKIDCLRT
DDTEICLNQNDVCKHEVLVDNGKKPDILIAKDDAMKKLQERFLKIMNDVADLSDEKHRLE
HIILQLQNETDTICEYVALYQQQRSLLKRRDEERSIQLNMFETECSKLKRQLEELTAILV
KLSEDEDISSCLQKHSKNIEIEQIMKLLTNLNNNSLIDPMKKSIDFKDFYPCSCCSGKLM
EI
*(80 a.a.)

- SilkBase 1999-2023 -