SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK13389_3prime_partial:A_BomoSK_comp13265_c0_seq3
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)
PREDICTED:_ETS-like_protein_pointed,_isoform_P2/D_isoform_X3_[Bombyx_mori]
Ontology
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006909 P phagocytosis
GO:0007157 P heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007265 P Ras protein signal transduction
GO:0007275 P multicellular organism development
GO:0007362 P terminal region determination
GO:0007422 P peripheral nervous system development
GO:0007424 P open tracheal system development
GO:0007426 P tracheal outgrowth, open tracheal system
GO:0007427 P epithelial cell migration, open tracheal system
GO:0007428 P primary branching, open tracheal system
GO:0007429 P secondary branching, open tracheal system
GO:0007455 P eye-antennal disc morphogenesis
GO:0007464 P R3/R4 cell fate commitment
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007507 P heart development
GO:0008284 P positive regulation of cell population proliferation
GO:0008293 P torso signaling pathway
GO:0008340 P determination of adult lifespan
GO:0009997 P negative regulation of cardioblast cell fate specification
GO:0030707 P ovarian follicle cell development
GO:0035225 P determination of genital disc primordium
GO:0043565 F sequence-specific DNA binding
GO:0045467 P R7 cell development
GO:0045610 P regulation of hemocyte differentiation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048190 P wing disc dorsal/ventral pattern formation
GO:0048747 P muscle cell development
GO:0050767 P regulation of neurogenesis
GO:0060438 P trachea development
GO:0060439 P trachea morphogenesis
GO:0061320 P pericardial nephrocyte differentiation
GO:0061331 P epithelial cell proliferation involved in Malpighian tubule morphogenesis
GO:0070491 F DNA-binding transcription factor binding
GO:2001234 P negative regulation of apoptotic signaling pathway
RNA-seq EntryA_BomoSK_comp13265_c0_seq3
Sequence
(Amino Acid)
MGIKVMMKAFNKPKDIPSQVPPLTPGTNKKMAEALKATFASWEKEQLRLGVPKDPRQWSE
AAVTAWLRWAAREFSLEGVALQQFARAQGKDICAMGREEFVARAPAFMGDILWEHLEILQ
KDVEKERSLLANVPPNMYESNVCLPELPEYIPPPAHHYNNNNNTGGYTTGGPRDTNAYGY
TESSGGAAPPPAPAASSPLDEYYQPEYPPAPAPTAQPYLEEYYHHAHAHTQPLLTHEPKY
QPHAYTKPYPRGAGGRYGEG
(85 a.a.)

- SilkBase 1999-2023 -