SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoSK13092_complete:A_BomoSK_comp13192_c0_seq2
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)		parp_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000715 P nucleotide-excision repair, DNA damage recognition
GO:0000717 P nucleotide-excision repair, DNA duplex unwinding
GO:0000724 P double-strand break repair via homologous recombination
GO:0000784 C chromosome, telomeric region
GO:0003677 F DNA binding
GO:0003910 F DNA ligase (ATP) activity
GO:0003950 F NAD+ ADP-ribosyltransferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005635 C nuclear envelope
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0005730 C nucleolus
GO:0005739 C mitochondrion
GO:0006273 P lagging strand elongation
GO:0006281 P DNA repair
GO:0006293 P nucleotide-excision repair, preincision complex stabilization
GO:0006294 P nucleotide-excision repair, preincision complex assembly
GO:0006295 P nucleotide-excision repair, DNA incision, 3'-to lesion
GO:0006296 P nucleotide-excision repair, DNA incision, 5'-to lesion
GO:0006302 P double-strand break repair
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006471 P protein ADP-ribosylation
GO:0006974 P cellular response to DNA damage stimulus
GO:0007005 P mitochondrion organization
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0008134 F transcription factor binding
GO:0008270 F zinc ion binding
GO:0010613 P positive regulation of cardiac muscle hypertrophy
GO:0016020 C membrane
GO:0016540 P protein autoprocessing
GO:0016740 F transferase activity
GO:0016757 F glycosyltransferase activity
GO:0016925 P protein sumoylation
GO:0019899 F enzyme binding
GO:0019901 F protein kinase binding
GO:0023019 P signal transduction involved in regulation of gene expression
GO:0030225 P macrophage differentiation
GO:0032042 P mitochondrial DNA metabolic process
GO:0032869 P cellular response to insulin stimulus
GO:0033683 P nucleotide-excision repair, DNA incision
GO:0034599 P cellular response to oxidative stress
GO:0036211 P protein modification process
GO:0042769 P obsolete DNA damage response, detection of DNA damage
GO:0042802 F identical protein binding
GO:0042826 F histone deacetylase binding
GO:0043234 C protein-containing complex
GO:0043504 P mitochondrial DNA repair
GO:0044822 F RNA binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0047485 F protein N-terminus binding
GO:0051103 P DNA ligation involved in DNA repair
GO:0051287 F NAD binding
GO:0060391 P positive regulation of SMAD protein signal transduction
GO:0070212 P protein poly-ADP-ribosylation
GO:0070412 F R-SMAD binding
GO:0070911 P global genome nucleotide-excision repair
GO:1903827 P regulation of protein localization
GO:1904357 P negative regulation of telomere maintenance via telomere lengthening
GO:2000679 P positive regulation of transcription regulatory region DNA binding
RNA-seq EntryA_BomoSK_comp13192_c0_seq2
Sequence
(Amino Acid)
MGINNISSRSTDTDDTVSPIEGHYKKLKAEIAPLDKTTDEFEMILEYVRNTHGKTHNFYT
LNVEEVFKVIREGEDKRYKPFKKLHNRRLLWHGSRTTNFAGIISQGLRIAPPEAPVTGYM
FGKGIYFADMVSKSANYCCTTRNNPVGLMLLCEVALGNMKECVNAEGFSKAPSGTHSVWG
VGRTEPDPKMNKELPDGLIVPLGTPVDRAENSTLLYNEFIVYDVAQVKVKYLIEMRFDYR
*(79 a.a.)

- SilkBase 1999-2023 -