SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoSK1299_5prime_partial:A_BomoSK_comp4075_c0_seq1
Scaffold_idBomo_Chr7
NCBI non-redundant
(nr)		male-specific_lethal_3_[Bombyx_mori]
Ontology
GO:0000228 C nuclear chromosome
GO:0000805 C X chromosome
GO:0003682 F chromatin binding
GO:0003723 F RNA binding
GO:0003729 F mRNA binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005700 C polytene chromosome
GO:0006338 P chromatin remodeling
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007549 P dosage compensation
GO:0009047 P dosage compensation by hyperactivation of X chromosome
GO:0010369 C chromocenter
GO:0016456 C X chromosome located dosage compensation complex, transcription activating
GO:0016568 P chromatin organization
GO:0016575 P histone deacetylation
GO:0019233 P sensory perception of pain
GO:0031936 P obsolete negative regulation of chromatin silencing
GO:0035064 F methylated histone binding
GO:0035206 P regulation of hemocyte proliferation
GO:0035267 C NuA4 histone acetyltransferase complex
GO:0043967 P histone H4 acetylation
GO:0043968 P histone H2A acetylation
GO:0072487 C MSL complex
RNA-seq EntryA_BomoSK_comp4075_c0_seq1
Sequence
(Amino Acid)
VSQSENEEPAPSTSTGEPRTFETLSSSVGSSGSSMSEGWTHPPKTAPVSTSTRTPLSLLL
EKVAKWQMIPRDGTEHLPCRVYGAIHLARLFVRLPDFLNASQMPDCKLRLIVRHIDMFVQ
YLNEHSEWFGESYYVADSISRSH
*(47 a.a.)

- SilkBase 1999-2023 -