SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK12788_3prime_partial:A_BomoSK_comp13081_c0_seq3
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
PREDICTED:_protein_arginine_N-methyltransferase_5_isoform_X2_[Bombyx_mori]
Ontology
GO:0000387 P spliceosomal snRNP assembly
GO:0001046 F core promoter sequence-specific DNA binding
GO:0003714 F transcription corepressor activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006353 P DNA-templated transcription, termination
GO:0006355 P regulation of transcription, DNA-templated
GO:0006479 P protein methylation
GO:0008168 F methyltransferase activity
GO:0008327 F methyl-CpG binding
GO:0016274 F protein-arginine N-methyltransferase activity
GO:0016568 P chromatin organization
GO:0016740 F transferase activity
GO:0018216 P peptidyl-arginine methylation
GO:0019918 P peptidyl-arginine methylation, to symmetrical-dimethyl arginine
GO:0032259 P methylation
GO:0032922 P circadian regulation of gene expression
GO:0034709 C methylosome
GO:0035243 F protein-arginine omega-N symmetric methyltransferase activity
GO:0035246 P peptidyl-arginine N-methylation
GO:0042118 P endothelial cell activation
GO:0043985 P histone H4-R3 methylation
GO:0044020 F histone methyltransferase activity (H4-R3 specific)
GO:0048511 P rhythmic process
GO:0090161 P Golgi ribbon formation
GO:1903507 P negative regulation of nucleic acid-templated transcription
RNA-seq EntryA_BomoSK_comp13081_c0_seq3
Sequence
(Amino Acid)
MAQQEISCGYEYIITADLQTCLTEALQCSYSFIVSPIIHPRFRRQSTNAGKNGGFTRSDM
VLSPQDWTSRIVAKLSPYINVDSPSATVRQRHEDYLNEELSYCRGLGVPA
(35 a.a.)

- SilkBase 1999-2023 -