SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK12461_complete:A_BomoSK_comp12969_c0_seq4
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)
PREDICTED:_potassium/sodium_hyperpolarization-activated_cyclic_nucleotide-gated_channel_2_isoform_X5_[Plutella_xylostella]
Ontology
GO:0000166 F nucleotide binding
GO:0002027 P regulation of heart rate
GO:0003254 P regulation of membrane depolarization
GO:0005216 F ion channel activity
GO:0005222 F intracellular cAMP-activated cation channel activity
GO:0005244 F voltage-gated ion channel activity
GO:0005248 F voltage-gated sodium channel activity
GO:0005249 F voltage-gated potassium channel activity
GO:0005267 F potassium channel activity
GO:0005272 F sodium channel activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006812 P cation transport
GO:0006813 P potassium ion transport
GO:0006814 P sodium ion transport
GO:0006936 P muscle contraction
GO:0008015 P blood circulation
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030552 F cAMP binding
GO:0031226 C intrinsic component of plasma membrane
GO:0034765 P regulation of ion transmembrane transport
GO:0035725 P sodium ion transmembrane transport
GO:0042391 P regulation of membrane potential
GO:0042802 F identical protein binding
GO:0048471 C perinuclear region of cytoplasm
GO:0055085 P transmembrane transport
GO:0055117 P regulation of cardiac muscle contraction
GO:0060078 P regulation of postsynaptic membrane potential
GO:0071320 P cellular response to cAMP
GO:0071321 P cellular response to cGMP
GO:0071805 P potassium ion transmembrane transport
GO:0086015 P SA node cell action potential
GO:0086091 P regulation of heart rate by cardiac conduction
RNA-seq EntryA_BomoSK_comp12969_c0_seq4
Sequence
(Amino Acid)
MSEMPKGDADMSLKQGSGTGKVHFGGLDDVSLYGTPVEPAPPAPDAKQGFLRNQLQALFQ
PTDNKLAMKLFGSKKALMKERIRQKAAGHWVIHPCSSFRFYWDLCMLLLLVANLIILPVA
ISFFNDDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWF
FLDLISSIPLDIYF
*(64 a.a.)

- SilkBase 1999-2023 -