SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoSK12114_complete:A_BomoSK_comp12847_c0_seq1
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)		PREDICTED:_leucine-rich_repeat_protein_soc-2_homolog_[Amyelois_transitella]
Ontology
GO:0002224 P toll-like receptor signaling pathway
GO:0002376 P immune system process
GO:0002755 P MyD88-dependent toll-like receptor signaling pathway
GO:0004872 F signaling receptor activity
GO:0004888 F transmembrane signaling receptor activity
GO:0005515 F protein binding
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006954 P inflammatory response
GO:0006955 P immune response
GO:0007165 P signal transduction
GO:0007250 P activation of NF-kappaB-inducing kinase activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030670 C phagocytic vesicle membrane
GO:0031410 C cytoplasmic vesicle
GO:0034150 P toll-like receptor 6 signaling pathway
GO:0035355 C Toll-like receptor 2-Toll-like receptor 6 protein complex
GO:0035663 F Toll-like receptor 2 binding
GO:0038124 P toll-like receptor TLR6:TLR2 signaling pathway
GO:0042088 P T-helper 1 type immune response
GO:0042496 P detection of diacyl bacterial lipopeptide
GO:0042742 P defense response to bacterium
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043507 P positive regulation of JUN kinase activity
GO:0045087 P innate immune response
GO:0045121 C membrane raft
GO:0045410 P positive regulation of interleukin-6 production
GO:0050702 P interleukin-1 beta production
GO:0050707 P regulation of cytokine production
GO:0071723 F lipopeptide binding
GO:0071726 P cellular response to diacyl bacterial lipopeptide
GO:1900227 P positive regulation of NLRP3 inflammasome complex assembly
RNA-seq EntryA_BomoSK_comp12847_c0_seq1
Sequence
(Amino Acid)
MDKTDKKCKKNGLTKPITTLEWAKDITAIDLSNKGISELTHNYTLPENLYDLDLSNNNLK
EVPSEVLKLTKLKTFNVSHNSITYFDDAPDFCNTIEQLNISNNALEGPPYWIWSNTPQKL
RNLNLSNNPNITKSLKKEYLEELMQYSTLVTDVDKRRNHNF
*(53 a.a.)

- SilkBase 1999-2023 -